NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F080263

Metagenome Family F080263

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080263
Family Type Metagenome
Number of Sequences 115
Average Sequence Length 87 residues
Representative Sequence MTEYPYILFNKSPEQLRQLGACGGRAYARNQRARRALVATPPETVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATPADQN
Number of Associated Samples 70
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.39 %
% of genes near scaffold ends (potentially truncated) 33.04 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 63
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.565 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(39.130 % of family members)
Environment Ontology (ENVO) Unclassified
(26.957 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.957 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.71%    β-sheet: 0.00%    Coil/Unstructured: 65.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01609DDE_Tnp_1 2.61
PF07592DDE_Tnp_ISAZ013 2.61
PF01555N6_N4_Mtase 1.74
PF08281Sigma70_r4_2 1.74
PF01695IstB_IS21 0.87
PF11149DUF2924 0.87
PF02954HTH_8 0.87
PF02517Rce1-like 0.87
PF13899Thioredoxin_7 0.87
PF13377Peripla_BP_3 0.87
PF09286Pro-kuma_activ 0.87
PF13493DUF4118 0.87
PF07638Sigma70_ECF 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.61
COG3293TransposaseMobilome: prophages, transposons [X] 2.61
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.61
COG5421TransposaseMobilome: prophages, transposons [X] 2.61
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.61
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.61
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.74
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.74
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.74
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.87
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.87
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.87
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.87
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.57 %
UnclassifiedrootN/A30.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005591|Ga0070761_11063673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium514Open in IMG/M
3300005591|Ga0070761_11101636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium505Open in IMG/M
3300005602|Ga0070762_10328968All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005602|Ga0070762_10952814Not Available587Open in IMG/M
3300005602|Ga0070762_11164276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium533Open in IMG/M
3300005610|Ga0070763_10145965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1231Open in IMG/M
3300005712|Ga0070764_10324112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium895Open in IMG/M
3300005921|Ga0070766_10515914Not Available795Open in IMG/M
3300005921|Ga0070766_10674051All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300005921|Ga0070766_10739717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium667Open in IMG/M
3300005921|Ga0070766_11019411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium570Open in IMG/M
3300005921|Ga0070766_11041602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium564Open in IMG/M
3300005938|Ga0066795_10099394Not Available866Open in IMG/M
3300006176|Ga0070765_100928733All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300006176|Ga0070765_102246302Not Available508Open in IMG/M
3300009029|Ga0066793_10572106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium644Open in IMG/M
3300009623|Ga0116133_1221771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium513Open in IMG/M
3300009638|Ga0116113_1175180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium546Open in IMG/M
3300009698|Ga0116216_10319470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium945Open in IMG/M
3300009762|Ga0116130_1154246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium724Open in IMG/M
3300009764|Ga0116134_1154911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium807Open in IMG/M
3300011270|Ga0137391_11052281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium660Open in IMG/M
3300014164|Ga0181532_10238203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1050Open in IMG/M
3300014169|Ga0181531_10458065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium786Open in IMG/M
3300014495|Ga0182015_10472925Not Available803Open in IMG/M
3300014657|Ga0181522_10086633All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300017941|Ga0187850_10322625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium682Open in IMG/M
3300017946|Ga0187879_10139541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1375Open in IMG/M
3300017946|Ga0187879_10161882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1263Open in IMG/M
3300017948|Ga0187847_10431208Not Available726Open in IMG/M
3300018013|Ga0187873_1339452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium549Open in IMG/M
3300018017|Ga0187872_10277121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium741Open in IMG/M
3300018030|Ga0187869_10218270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium929Open in IMG/M
3300018033|Ga0187867_10111987All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300018034|Ga0187863_10654280All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium592Open in IMG/M
3300018035|Ga0187875_10360356Not Available781Open in IMG/M
3300018035|Ga0187875_10504022Not Available642Open in IMG/M
3300018038|Ga0187855_10256521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1026Open in IMG/M
3300018042|Ga0187871_10139278All Organisms → cellular organisms → Bacteria → Acidobacteria1376Open in IMG/M
3300018043|Ga0187887_10031785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3318Open in IMG/M
3300018043|Ga0187887_10272407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1000Open in IMG/M
3300018047|Ga0187859_10035478Not Available2683Open in IMG/M
3300021181|Ga0210388_10908456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium759Open in IMG/M
3300021181|Ga0210388_11534969Not Available555Open in IMG/M
3300021402|Ga0210385_10808413Not Available719Open in IMG/M
3300021402|Ga0210385_10812924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium717Open in IMG/M
3300021406|Ga0210386_10703911Not Available871Open in IMG/M
3300021433|Ga0210391_11332110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium553Open in IMG/M
3300021477|Ga0210398_11203906Not Available598Open in IMG/M
3300021477|Ga0210398_11629889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium500Open in IMG/M
3300021559|Ga0210409_11431587Not Available567Open in IMG/M
3300022873|Ga0224550_1018904Not Available973Open in IMG/M
3300026217|Ga0209871_1004515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2728Open in IMG/M
3300027648|Ga0209420_1188818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium551Open in IMG/M
3300027853|Ga0209274_10056109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41879Open in IMG/M
3300027853|Ga0209274_10235053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium936Open in IMG/M
3300027853|Ga0209274_10405774Not Available704Open in IMG/M
3300027879|Ga0209169_10066282All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300027884|Ga0209275_10128014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1327Open in IMG/M
3300027884|Ga0209275_10353745Not Available823Open in IMG/M
3300027889|Ga0209380_10193437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1194Open in IMG/M
3300027895|Ga0209624_10328073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1020Open in IMG/M
3300028747|Ga0302219_10219011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium736Open in IMG/M
3300028780|Ga0302225_10332809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium718Open in IMG/M
3300028798|Ga0302222_10153760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium907Open in IMG/M
3300028906|Ga0308309_11488637Not Available578Open in IMG/M
3300029910|Ga0311369_11240917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium573Open in IMG/M
3300029910|Ga0311369_11257239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium568Open in IMG/M
3300029943|Ga0311340_10757119Not Available825Open in IMG/M
3300029943|Ga0311340_11213788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium606Open in IMG/M
3300029943|Ga0311340_11319781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium574Open in IMG/M
3300029951|Ga0311371_11962483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium623Open in IMG/M
3300029951|Ga0311371_12132250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium588Open in IMG/M
3300029993|Ga0302304_10131459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium948Open in IMG/M
3300029999|Ga0311339_10620034Not Available1073Open in IMG/M
3300029999|Ga0311339_10668993Not Available1021Open in IMG/M
3300029999|Ga0311339_10754366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium944Open in IMG/M
3300029999|Ga0311339_11070021Not Available749Open in IMG/M
3300030007|Ga0311338_10313514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1725Open in IMG/M
3300030053|Ga0302177_10471450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium651Open in IMG/M
3300030053|Ga0302177_10616495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium553Open in IMG/M
3300030054|Ga0302182_10237996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium774Open in IMG/M
3300030058|Ga0302179_10360075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium641Open in IMG/M
3300030399|Ga0311353_10645103All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia920Open in IMG/M
3300030399|Ga0311353_11170596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium636Open in IMG/M
3300030520|Ga0311372_10948440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1146Open in IMG/M
3300030520|Ga0311372_10967873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1130Open in IMG/M
3300030524|Ga0311357_10717032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium907Open in IMG/M
3300030617|Ga0311356_11794792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium547Open in IMG/M
3300030618|Ga0311354_10389175Not Available1411Open in IMG/M
3300030618|Ga0311354_10718092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium954Open in IMG/M
3300031234|Ga0302325_10075479All Organisms → cellular organisms → Bacteria6484Open in IMG/M
3300031234|Ga0302325_10241536All Organisms → cellular organisms → Bacteria3025Open in IMG/M
3300031234|Ga0302325_10415262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium2087Open in IMG/M
3300031234|Ga0302325_11251531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium981Open in IMG/M
3300031234|Ga0302325_11299619Not Available957Open in IMG/M
3300031234|Ga0302325_11391760Not Available913Open in IMG/M
3300031234|Ga0302325_12499368Not Available616Open in IMG/M
3300031236|Ga0302324_100283133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2557Open in IMG/M
3300031236|Ga0302324_101959240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium737Open in IMG/M
3300031236|Ga0302324_102367703Not Available653Open in IMG/M
3300031236|Ga0302324_103599082Not Available500Open in IMG/M
3300031525|Ga0302326_10499431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1844Open in IMG/M
3300031525|Ga0302326_10705188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1474Open in IMG/M
3300031525|Ga0302326_12231903Not Available697Open in IMG/M
3300031525|Ga0302326_12950656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium582Open in IMG/M
3300031525|Ga0302326_12958010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium581Open in IMG/M
3300031525|Ga0302326_13175720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium555Open in IMG/M
3300033829|Ga0334854_165562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium538Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa39.13%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil20.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.74%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.87%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.87%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.87%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.87%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070761_1106367323300005591SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPE
Ga0070761_1110163613300005591SoilMTEYPYILFNKSPEQLRQLGASGGRANARNQRARRALIATPPEAEPAPTIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATPADQN*
Ga0070762_1032896823300005602SoilMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAAATPADQN*
Ga0070762_1095281413300005602SoilMAEYPHINKSPEQLREMGACGGRANPRNQRARRALVATPPEVVPPPALPQQTTAEAIHVLDAQFPWLRGAERKRSRNREWVPAPASVAVLRRATKRGWRKR*
Ga0070762_1116427613300005602SoilYILFNKSPEQLRQLGACGGRANARNQRARRALVATPPEAVPPPAIPEQTTAEAIHLLDTQFPWLRGAEKKRSRNREWFPAPATCAHQN*
Ga0070763_1004482453300005610SoilMTEFPYILFNKTPEQLRHLGARGGKAYGRNQRARRALAATPPQTVPSAAVPRKTAAEANHSLDTQFPWLRGAER*
Ga0070763_1014596513300005610SoilMTEYPYILFNKSPEQLRQLGASGGRANARNQRARRALIATPPEAEPAPTIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVP
Ga0070764_1032411223300005712SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAAATPADQN*
Ga0070766_1051591413300005921SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPQTVPPATVTRKTAAQANHSLDTQFPWLRGAER*
Ga0070766_1067405113300005921SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPAAVPGKTAAQAIHSLDSQFPWLRGAER*
Ga0070766_1073971713300005921SoilMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVP
Ga0070766_1101941123300005921SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATPA
Ga0070766_1104160223300005921SoilMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPETVPPPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAP
Ga0066795_1009939423300005938SoilMTEYPYILFNKSPEQMHHLGACGGRAYGRNQRARRALVATPPEAVPPPAVPRQTAAQAIRLLDTQFPWLRAAER*
Ga0070765_10092873313300006176SoilMTEYPYILFNKSPEQLRQLGASGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNLAWVPAAATPADQN*
Ga0070765_10224630213300006176SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPAAVPGKTAAQSIHSLDAQFPWAARRGKVTPSLPHL*
Ga0066793_1057210613300009029Prmafrost SoilMNEYPYILFNKSPEQMRHLGACGGRAYGRNQRARRALLTTPPEAVPPAAVPRPTAAEAIHLLDTRFPWLRGAEG*
Ga0099828_1073554813300009089Vadose Zone SoilRYPYILFNKSPEQLRRLGACGGKANARNQRARRALVLTPLPPATPRPVPGETATQAITVLDAQFPWLRGAEKRVSRNQAAPGIQF*
Ga0116133_122177113300009623PeatlandPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQTAAEAIHLLDAQFPWLRGAEG*
Ga0116113_117518013300009638PeatlandMTQYPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQTAAEAIHLLDAQFPWLRGAEG*
Ga0116216_1031947013300009698Peatlands SoilMNVVRRTNTMTEYPYILFNKSPEQMRQLGACGGRAYGRNQRARRALVATPPETVPPPARPQQTATEAIHLLDTQFPWLRGAER*
Ga0116130_115424613300009762PeatlandLLDAHPYILFNKSPEQMRQLGACGGRAYGRHERARRALVTATPAPVPPPELPQQTAAEAIHLLDAQFPWLRGAEG*
Ga0116134_115491113300009764PeatlandMTEYPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQTAAEAIHLLDAQFPWLRGAEG*
Ga0074044_1091896113300010343Bog Forest SoilMNVVSGDTMTQYPYILFNKSPEQLRLLGARGGRAYGRSQRARRALGATPPPAVPPCAASPATTAESIIVLDARFPWLRGAEKQRS*
Ga0137391_1105228113300011270Vadose Zone SoilNYPYILFNKSPEQLRRLGACGGKANARNQRARRALVPTPLQPVPPRPVPGETATQAITVLDAQFPWLRGAEKRVSRNEGSARGTQF*
Ga0181532_1023820333300014164BogMTEYPYILFNKSPEQLRQLGACGGRAYARNQRARRALVATPPETVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRANQN*
Ga0181531_1045806513300014169BogPYILFNKSPEQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRADQN*
Ga0182015_1047292513300014495PalsaEHTMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATQPEAVPPPALPPQTTAEDIHVLDTQFPWLRGAERKRSRNREWVPAPATRADQN*
Ga0181522_1008663333300014657BogMTQYPYILFNKSPEQLRRLGARGGRAHGRNQRARRALAATQPDVAPPPAVPQGTTADSIGVLDAQFPWLRGAERRPARKAA*
Ga0187850_1032262513300017941PeatlandMTEYPYILFNKSPEQLRQLGACGGRAYARNQRARRALVATPPETVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0187879_1013954123300017946PeatlandMTQYPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQTAAEAIHLLDAQFPWLRGAEG
Ga0187879_1016188233300017946PeatlandMTEYPYILFNKSPEQMRQLGASGGRAYGRNERARRALLATLPEATPPPALPQQSTAEAIHLLDTQFPWLRGAER
Ga0187847_1043120813300017948PeatlandMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALVATPPEVVPPPALPQQTTAEDIHLLDNQFPWLRSAERKRSRNREWIPAPATPADQN
Ga0187873_133945213300018013PeatlandMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRA
Ga0187872_1027712123300018017PeatlandYPYILFNKSPEQMRQLGASGGRAYGRNERARRALLATLPEATPPPALPQQSTAEAIHLLDTQFPWLRGAER
Ga0187869_1021827023300018030PeatlandMTEYPYILFNKSPEQMRQLGACGGRAYGRKQRARRALLATLPEAAPPPALPQQTTAEAIHLLDTQFPWLRGAER
Ga0187867_1011198733300018033PeatlandMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRANQN
Ga0187863_1065428023300018034PeatlandMTEYPYILFNKSPEQLRQLAASGGRANARNQRARRALIATPPEAEPATAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0187875_1036035613300018035PeatlandLLDAHPYILFNKSPEQMRQLGACGGRAYGRKQRARRALLATLPEAAPPPAVPQQTAAQAIHCLDLQFPWLRGAER
Ga0187875_1050402213300018035PeatlandMTEYPYILFNKTPEQMRQLGASGGRAYGRNQRARRALVATLPEAAQPPAVPEKTAAEAIHSLDIQFPWLRGAER
Ga0187855_1025652113300018038PeatlandMTEYPYILFNKSPEQLRQLGACGGRAYARNQRARRALVATPPETVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRANQN
Ga0187871_1013927813300018042PeatlandMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPAAVPGKTAAQAIHSLDSQFPWLRGAER
Ga0187887_1003178553300018043PeatlandMTEYPYILFNKSPEQLRQLGACGGRAYARNQRLRRALVATPPETVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRANQN
Ga0187887_1027240713300018043PeatlandMWCGEHTMTQYPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQTAAEAIHLLDAQFPWLRGAEG
Ga0187890_1018645233300018044PeatlandMTEYPYILFNKSPEQLRELGACGGRAYARNQRARRALLATLPEAAPPPAVPQQTAAQAIHCLDLQFPWLRGAER
Ga0187859_1003547813300018047PeatlandMTQYPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTATPEAVPPPELPQQAAAEAIHLLDAQFPWLRGAEG
Ga0210388_1090845623300021181SoilLLDAHPYILFNKSPEQLRELGACGGRASARNQRARRALAATPPEVVPAPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNLAWVPAAATPADQN
Ga0210388_1153496913300021181SoilMTEFPYILFNKSPEQMRQLGACGGRAYGRNERARRALVTTPPEAVPPTARPQQTAAEAIHILDTQFPWLRGAER
Ga0210385_1018159913300021402SoilMTEFPYILFNKTPEQLRHLGARGGKAYGRNQRARRALAATPPQTVPSAAVPRKTAAEANHSLDTQFPWLRGAER
Ga0210385_1080841313300021402SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPPAVPRKTAAQANHSLDTQFPWLRGAER
Ga0210385_1081292413300021402SoilMTEYPYILFNKSPEQLRQLGASGGRANARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAAATPADP
Ga0210386_1070391123300021406SoilMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNSEWVPAPATRADQN
Ga0210391_1133211013300021433SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATPPEAEPATAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0210398_1120390613300021477SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPQTVPSAAVPRKTAAEANHSLDTQFPWLRGAER
Ga0210398_1162988913300021477SoilMNCTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0210409_1143158713300021559SoilMTQYPYILFNKSPEQLRRLGARGGKAYGRNQRIRPARVPTLPIALPPPAVPQETAATAIQLLDTQFPWLRGAERQRCRNQACTPLK
Ga0224550_101890413300022873SoilMTEYPYILFNKSPEQLRQLGACGGRASARNQRASRALLATLPEATPPPALPQQTTAADIHVLDTHFPWLRGAEGKRSRNREWVPAPATPADQN
Ga0209871_100451543300026217Permafrost SoilMTEYPYILFNKSPEQMHHLGACGGRAYGRNQRARRALVATPPEAVPPPAVPRQTAAQAIRLLDTQFPWLRAAER
Ga0209420_118881813300027648Forest SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0209274_1005610923300027853SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPPAVPRKTAAQAIHSLDTQFPWLRGAER
Ga0209274_1023505313300027853SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATPPEAEPAPTIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0209274_1035445523300027853SoilREHTMTEFPYILFNKSPEQLRQLGARGGKAYGRNQRARRALAATPPETVPPTAVPGKTAAQAIHSLDTQFPWLRGAER
Ga0209274_1040577413300027853SoilMTEFPYILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPAAVPGKTAAQAIHSLDTQFPWLRGAER
Ga0209169_1006628223300027879SoilMTEYPHINKSPEQLREMGACGGRANPRNQRARRALVATPPEVVPPPALPQQTTAEAIHVLDAQFPWLRGAERKRSRNREWVPAPASVAVLRRATKRGWRKR
Ga0209275_1012801423300027884SoilMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALIATPPEAEPAPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0209275_1035374513300027884SoilCREHTMAEYPHINKSPEQLREMGACGGRANPRNQRARRALVATPPEVVPPPALPQQTTAEAIHVLDAQFPWLRGAERKRSRNREWVPAPASVAVLRRATKRGWRKR
Ga0209380_1019343723300027889SoilMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0209624_1032807313300027895Forest SoilMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALIATPPETVPPPAIPAQTAAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0302219_1021901113300028747PalsaMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNREWVPAPATRADQN
Ga0302225_1033280923300028780PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALVATPPEAVPPPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATPADQNQRCAR
Ga0302222_1015376013300028798PalsaCREHTMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNREWVPAPATPANQN
Ga0308309_1148863723300028906SoilILFNKSPEQMRQLGARGGKAYGRNQRARRALAATPPETVPPAAVPGKTAAQSIHSLDAQFPWLRGAER
Ga0311369_1124091713300029910PalsaMNVVPEHTMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAAATP
Ga0311369_1125723913300029910PalsaMTEYPYILFNKSPEQLRELGACGGRASARNQRARRALVATPPEAVPPPAIPEQTTAEAIHLLDTRFPWLRGAEKKRSRNREWVPAPARCADQN
Ga0311340_1075711913300029943PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALLATLPEAVPPPALPQQTTAADIQVLDTQFPWLRGAERKRSRSPEWVAAAATRADQN
Ga0311340_1121378813300029943PalsaMWCREHTMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATPPETVPPPAIPAQTTAEAIHLLDAQFPWLRGAERKRSRNREWVPAPATPANQN
Ga0311340_1131978113300029943PalsaMTEYPYILFNKSPEQMRQLGACGGRASARNQRARRALVATPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVWVPAPATCADQN
Ga0311371_1196248313300029951PalsaMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNREWVPAPATPANQN
Ga0311371_1213225013300029951PalsaHTMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNREWVPAPATRADQN
Ga0302304_1013145923300029993PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0311339_1062003423300029999PalsaLFNKSPEQMRQLGACGGRANARNQRARRALVATASEAVPPPALPQQTTAEDIQVLDTQFPWLRHAERKRSRNREWVVPGSGAHQSIP
Ga0311339_1066899333300029999PalsaMNVVPEHTMTEYPYILFNKSPERLRQLGACGGRANARNQRARRALVATLPEAVPPPALPQQTTAEDIQLLDTQFPWLRGAERKRSRNRERVPAPATPADQN
Ga0311339_1075436633300029999PalsaMRQLGACGGRANARNQRARRALVATPPEAVPPPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0311339_1107002113300029999PalsaMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVVTPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0311338_1031351423300030007PalsaMTEYPYILFNKSPEQMRQLGACGGRASARNQRARRALVAAPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVWVPAPATCADQN
Ga0302177_1047145023300030053PalsaEHTMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0302177_1061649513300030053PalsaMTEYPYILFNKSPEQMRQLGACGGRASARNQRARRALVAAPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVW
Ga0302182_1023799613300030054PalsaMTEYPYILFNKSPEQMRQLGACGGRASARNQRARRALVATPPETVPPPAIPAQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0302179_1036007513300030058PalsaHTMTEYPYILFNKSPEQLRELGACGGRASARNQRARRALVATPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVWVPAPATCADQN
Ga0311353_1064510313300030399PalsaMTEYPYILFNKSPEQLRELGACGGRASARNQRARRALVATPPEAVPPPAIPEQTTAEAIHLLDTRFPWLRGAE
Ga0311353_1117059613300030399PalsaMNVVPEHTMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAAATPADQN
Ga0311372_1094844033300030520PalsaMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATPPETVPPPAIPAQTTAEAIHLLDAQFPWLRGAERKRSRNREWVPAPATPANQN
Ga0311372_1096787323300030520PalsaMTEYPYILFNKSPEQLRQLGACGGRAYGRNQRARRALVATQPEAVPPPALPPQTTAEDIHVLDTQFPWLRGAERKRSRN
Ga0311357_1071703223300030524PalsaMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALVAAPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVWVPAPATCADQN
Ga0311356_1179479223300030617PalsaPYILFNKSPEQLRQLGACGGRASARNQRARRALVATPPEAVPPPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0311354_1038917513300030618PalsaMTEYPYILFNKSPEQLRQLGACGGRAYGRNQRARRALVATQPEAVPPPALPPQTTAEDIHVLDTQFPWLRGAERKRSRNREWVRAPATPAD
Ga0311354_1071809213300030618PalsaMNVVPEHTMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALIATLPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNREWVPAPATPANQN
Ga0302325_1007547953300031234PalsaMTEYPYILFNKSPEQLRQLGACGGRAYGRNQRARRALVATQPEAVPPPALPPQTTAEDIHVLDTQFPWLRGAERKRSRNGEWVPAPATPADQN
Ga0302325_1024153623300031234PalsaMTEYPYILFNKSPELMRQLGACGGRASARNQRARRALVATPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRVWVPAPATCADQN
Ga0302325_1041526213300031234PalsaMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0302325_1125153113300031234PalsaEHTMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNREWVPAPATRADQN
Ga0302325_1129961913300031234PalsaMTEYPYILFNKSPEQMRQLGASGGRAYGRNERARRALLATLPEATPPPALPPQTTAAAIHLLDTQFPWLRGAER
Ga0302325_1139176013300031234PalsaMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVVTPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNSEWVPAPATRADQN
Ga0302325_1249936823300031234PalsaPYILFNKSPERLRQLGACGGRANARNQRARRALVATLPEAVPPPALPQQTTAEDIQLLDTQFPWLRGAERKRSRNRERVPAPATPADQN
Ga0302324_10028313323300031236PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALVATPPEAAPPPALPQQTTAEDIQVLDTQFPWLRGAERKRSRNPEWVPAPATPADQN
Ga0302324_10195924013300031236PalsaMTEYPYILFNKSPKQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEW
Ga0302324_10236770313300031236PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALLATLPEAVPPPALPQQTTAADIQVLDTQFPWLRGAERKRSRSPEWVAAAATRADQD
Ga0302324_10359908213300031236PalsaMTEYPYILFNKSPEQLRQLGACGGRASARNQRARRALVPTPPEVVPPPALPQQTTAEDIQVLDTQFPWLRGAERKRSRNRERVPAPTTCADQN
Ga0302326_1049943153300031525PalsaTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNREWVPAPATRADQN
Ga0302326_1070518813300031525PalsaMTEYPYILFNKSPEQMRQLGACGGRASARNQRARRALVAAPPEAVPPPALPQQTTAEAIHLLDAQFPWLQGAERKRSRNRV
Ga0302326_1223190323300031525PalsaMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATPPEAVPPPALPQQTTAEDIHLLDTQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0302326_1295065623300031525PalsaMTEYPYILFNKSPEQLRQLGACGGRANARNQRARRALVATPPEAVPPPALPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWV
Ga0302326_1295801013300031525PalsaEHTMTEYPYILFNKSPEQMRQLGACGGRANARNQRARRALVATPPEAVPPPAIPQQTTAEAIHLLDTQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0302326_1317572013300031525PalsaEYPYILFNKSPKQLRQLGACGGRASARNQRARRALVATPPESEPAPAIPQQTTAEAIHLLDAQFPWLRGAERKRSRNPEWVPAPATRADQN
Ga0334854_165562_291_5363300033829SoilMTEYPYILFNKSPEQLRQLGACGGRAAARNQRARRALVATPPETVPPPAIPAQTTAEAIHLLDAQFPWLRGAERKRSRNREW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.