NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080259

Metagenome / Metatranscriptome Family F080259

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080259
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 110 residues
Representative Sequence RGIVEIIAFVLLDQDLVKHDRSEVGVEYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR
Number of Associated Samples 101
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.51 %
% of genes near scaffold ends (potentially truncated) 91.30 %
% of genes from short scaffolds (< 2000 bps) 90.43 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.522 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(17.391 % of family members)
Environment Ontology (ENVO) Unclassified
(54.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.565 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.61%    β-sheet: 0.00%    Coil/Unstructured: 39.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF04075F420H2_quin_red 7.83
PF00072Response_reg 3.48
PF00561Abhydrolase_1 3.48
PF13686DrsE_2 2.61
PF12724Flavodoxin_5 1.74
PF00455DeoRC 1.74
PF04358DsrC 0.87
PF04120Iron_permease 0.87
PF00850Hist_deacetyl 0.87
PF00903Glyoxalase 0.87
PF01243Putative_PNPOx 0.87
PF09364XFP_N 0.87
PF08327AHSA1 0.87
PF08242Methyltransf_12 0.87
PF00211Guanylate_cyc 0.87
PF00589Phage_integrase 0.87
PF01408GFO_IDH_MocA 0.87
PF13463HTH_27 0.87
PF11716MDMPI_N 0.87
PF12840HTH_20 0.87
PF03960ArsC 0.87
PF12697Abhydrolase_6 0.87
PF07690MFS_1 0.87
PF14018DUF4234 0.87
PF00326Peptidase_S9 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG1349DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR familyTranscription [K] 3.48
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 1.74
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.74
COG1393Arsenate reductase or related protein, glutaredoxin familyInorganic ion transport and metabolism [P] 0.87
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.87
COG2920Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)Translation, ribosomal structure and biogenesis [J] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908040|B4_c_ConsensusfromContig76222Not Available2061Open in IMG/M
3300000567|JGI12270J11330_10120286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1072Open in IMG/M
3300001532|A20PFW1_1027754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium672Open in IMG/M
3300002549|JGI24130J36418_10004352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4827Open in IMG/M
3300004080|Ga0062385_11101353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300005177|Ga0066690_10995019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300005541|Ga0070733_10686202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300006059|Ga0075017_100636288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300006162|Ga0075030_101427881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300006176|Ga0070765_101682934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium596Open in IMG/M
3300006176|Ga0070765_102315349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300006795|Ga0075520_1011129All Organisms → cellular organisms → Bacteria4541Open in IMG/M
3300006795|Ga0075520_1167262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium949Open in IMG/M
3300006950|Ga0075524_10199371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium871Open in IMG/M
3300009137|Ga0066709_102652995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300009518|Ga0116128_1116727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium779Open in IMG/M
3300009521|Ga0116222_1286146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium712Open in IMG/M
3300009523|Ga0116221_1132112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1092Open in IMG/M
3300009525|Ga0116220_10545870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300009547|Ga0116136_1033307All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300009549|Ga0116137_1212429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium514Open in IMG/M
3300009615|Ga0116103_1116481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi669Open in IMG/M
3300009616|Ga0116111_1003114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9387Open in IMG/M
3300009630|Ga0116114_1176030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300009637|Ga0116118_1134001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium810Open in IMG/M
3300009646|Ga0116132_1148627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium714Open in IMG/M
3300009683|Ga0116224_10028408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2750Open in IMG/M
3300009683|Ga0116224_10144696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1145Open in IMG/M
3300009698|Ga0116216_10247979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1088Open in IMG/M
3300009824|Ga0116219_10193926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1165Open in IMG/M
3300009824|Ga0116219_10823371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300010341|Ga0074045_10360091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium947Open in IMG/M
3300010343|Ga0074044_10766791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium630Open in IMG/M
3300010379|Ga0136449_103126579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300010880|Ga0126350_11211411Not Available4785Open in IMG/M
3300012923|Ga0137359_11080726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium687Open in IMG/M
3300014156|Ga0181518_10346228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300014158|Ga0181521_10218184All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300014158|Ga0181521_10226517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1003Open in IMG/M
3300014158|Ga0181521_10530770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300014158|Ga0181521_10606035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300014164|Ga0181532_10243450All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300014164|Ga0181532_10547382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium631Open in IMG/M
3300014165|Ga0181523_10645593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300014200|Ga0181526_10646121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium668Open in IMG/M
3300014657|Ga0181522_11016757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium514Open in IMG/M
3300014838|Ga0182030_10879801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium806Open in IMG/M
3300016341|Ga0182035_10619393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium937Open in IMG/M
3300016357|Ga0182032_11105261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300016387|Ga0182040_11228034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium631Open in IMG/M
3300016404|Ga0182037_10725224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium852Open in IMG/M
3300016404|Ga0182037_11225302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium660Open in IMG/M
3300016730|Ga0181515_1204690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium530Open in IMG/M
3300017926|Ga0187807_1199413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium648Open in IMG/M
3300017931|Ga0187877_1366197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium546Open in IMG/M
3300017935|Ga0187848_10122168All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300017940|Ga0187853_10015786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4332Open in IMG/M
3300017940|Ga0187853_10279157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium760Open in IMG/M
3300017972|Ga0187781_10721497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium721Open in IMG/M
3300018003|Ga0187876_1039251All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300018006|Ga0187804_10565877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300018035|Ga0187875_10543575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300018037|Ga0187883_10676446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300018038|Ga0187855_10254989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1029Open in IMG/M
3300018042|Ga0187871_10262197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium959Open in IMG/M
3300018044|Ga0187890_10266998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium962Open in IMG/M
3300018085|Ga0187772_10939539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium630Open in IMG/M
3300018085|Ga0187772_11289931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium540Open in IMG/M
3300018088|Ga0187771_10942270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium732Open in IMG/M
3300021388|Ga0213875_10588749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium537Open in IMG/M
3300024330|Ga0137417_1017527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300025432|Ga0208821_1034349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1001Open in IMG/M
3300025457|Ga0208850_1033767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium876Open in IMG/M
3300025473|Ga0208190_1072122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium697Open in IMG/M
3300025506|Ga0208937_1078158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium750Open in IMG/M
3300025829|Ga0209484_10176608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300025854|Ga0209176_10061615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium847Open in IMG/M
3300026318|Ga0209471_1224892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium685Open in IMG/M
3300027625|Ga0208044_1201624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium531Open in IMG/M
3300027641|Ga0208827_1091394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium921Open in IMG/M
3300027662|Ga0208565_1103792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium854Open in IMG/M
3300027662|Ga0208565_1205960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium558Open in IMG/M
3300027854|Ga0209517_10019394All Organisms → cellular organisms → Bacteria6437Open in IMG/M
3300027854|Ga0209517_10368149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium818Open in IMG/M
3300027854|Ga0209517_10428594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium736Open in IMG/M
3300028060|Ga0255359_121596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium591Open in IMG/M
3300028906|Ga0308309_11850542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300030494|Ga0310037_10385163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium583Open in IMG/M
3300030706|Ga0310039_10126558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1049Open in IMG/M
3300031544|Ga0318534_10757385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300031640|Ga0318555_10304280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium863Open in IMG/M
3300031672|Ga0307373_10580533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300031680|Ga0318574_10263777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium998Open in IMG/M
3300031744|Ga0306918_10308415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1221Open in IMG/M
3300031821|Ga0318567_10621294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium613Open in IMG/M
3300031833|Ga0310917_11142166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium519Open in IMG/M
3300031846|Ga0318512_10461026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300031896|Ga0318551_10851948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium531Open in IMG/M
3300031897|Ga0318520_10978616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300031910|Ga0306923_10821878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1024Open in IMG/M
3300031954|Ga0306926_10438347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1610Open in IMG/M
3300031962|Ga0307479_11055472All Organisms → cellular organisms → Bacteria → Terrabacteria group780Open in IMG/M
3300032001|Ga0306922_10520461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1267Open in IMG/M
3300032043|Ga0318556_10470108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium658Open in IMG/M
3300032055|Ga0318575_10153868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1144Open in IMG/M
3300032060|Ga0318505_10302322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium755Open in IMG/M
3300032068|Ga0318553_10318369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium814Open in IMG/M
3300032076|Ga0306924_10034533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5517Open in IMG/M
3300032094|Ga0318540_10546532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300032160|Ga0311301_13000909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300032261|Ga0306920_102490456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium712Open in IMG/M
3300032805|Ga0335078_10568543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1438Open in IMG/M
3300033290|Ga0318519_10730550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300033402|Ga0326728_11174828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil17.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland9.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.57%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.70%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil6.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.87%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908040Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025829Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300028060Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T25EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B4_c_007965202124908040SoilMMGDFRDPGIXXVLAIVARGIIEIVAFVLLDQDLVXHXYXEVGVEXEXSLXFGSFGQAVPAPDXARVKGXNNYAGXXVATVXSXGIXLFWWXYDQMNDPXRHFQTNWYQEDALVAAXQALRXRXDLVPXXATVTTRGXRVSGGFP
JGI12270J11330_1012028623300000567Peatlands SoilLDQDLVKHDRSEVGVEYELAVMFGRFGQTVSAPDQARVKGQNNYVGRIVATVFSLGIYLFWWYYDQMIVPNLHFQTNWVQEDSLAVAVHALR*
A20PFW1_102775413300001532PermafrostVLLDQDLVQHDYSEVGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR*
JGI24130J36418_1000435263300002549Arctic Peat SoilMVTLRRMMGDFRDPGIWLVLAIVARGIIEIVAFVLLDQDLVQHDYSEVGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR*
Ga0062385_1110135323300004080Bog Forest SoilLIAFVLLDMDLVKHEGSELGVEYELSLIFGRFGHNLPAGDGSEVKGRNNYVGRIVATLVSFGVYLFWWYYNQMEDPNRHFRANWLQEDALVAAVQQTTG*
Ga0066690_1099501913300005177SoilARGIIEIVAFVLLDQDLVTHDRAEVGVEYEISVIYTALGQQVPLPDQSRVKASDYYVGRILATIFSFGIYLFWWYYNQMDQPNAHFRANWPAEDALVRAVEALA*
Ga0070733_1068620223300005541Surface SoilPVIFVVLDVVARGLVEFIAFVLLDQDLVKHDRSEVGVEYELATMFGRFGQAVSAPDQTRVKGQNNYVGRIVATVFSLGIYLFWWYYDQMIVPNRHFQTNWVQEDSLAAAVYALR*
Ga0075017_10063628823300006059WatershedsDQDLVKHDRSEVGVEYELSVIFGRFGLAVPAPDQGRVKGQNNYVGRIVALIASFGIYGLWWYYDQMIEPNRNFQANWPEEDALVAAVQALR*
Ga0075030_10142788123300006162WatershedsMNQDFREPVVWLILAIVARGIVEIIAFVLLDQDLVKHDRSEVGVEYELSIIFGRFGQTVTAPDQGRVKGENNYVGRILATIFSFGIYLFWWYYNQMEDPNCHFQTNWAQEDSLVAAANGLRS*
Ga0070765_10168293413300006176SoilPSFQRAEAHMSVLRRMTTDFRDPVIWLVLSIVARGIVELIAFVLMDQDLVKHDRSEVGVEYELSLIFGRMGHAVPEPDQGRVKSQNNYAGRIVATVFSLGIYLFWWYHDQMVVPNRHFQTNWAQEDSLAAAVGALR*
Ga0070765_10231534923300006176SoilRSEVGVEYELSLIFGRLGQAVPAPDQDRVKGQNNYVGRILATIFSLGIYLFWWYYNQMNDPNHHFRTNWAQEDALVAAANGLRA*
Ga0075520_101112913300006795Arctic Peat SoilTLRRMMGDFRDPGIWLVLAIVARGIIEIVAFVLLDQDLVKHDYCEVGVEYELSLIFGSFGQMVPAPDQARVKGENNYAGRIVATVFSCGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR*
Ga0075520_116726223300006795Arctic Peat SoilTLRRMMGDFRDPGIWLVLAIVARGIIEIVAFVLLDQDLVKHNYSEGGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR*
Ga0075524_1019937113300006950Arctic Peat SoilFQRAEAHMVTLRRMMGDFRDPGIWLVLAIVARGLIEIVAFVLLDQDLVKHNYSEGGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR*
Ga0066709_10265299523300009137Grasslands SoilVARGIIEIVAFVLLDQDLVRHDRAEVGVEYEISIIYTALGQQVPLPDQSRVKASDNYVGRILATIFSFGIYMFWWYYNQMDQPNAHFRGNWPAEDALVRAVEALGTRDPR*
Ga0116128_111672713300009518PeatlandDPELSRARRLGRAGRRPRGIAELIAFILLDQDIVRHDRSEVGVEYELALIFWRLGQPLSVPDQTRVKMQNNYVGRIVATIVSFGIYLLWWYYDQMIEPNLHFRTNWAQEDALVAAVQALR
Ga0116222_128614613300009521Peatlands SoilFVLLDKDLVKHDCAEVGVEYELSLIFRRFGQAVPEPDQTRIKGENNYVGRIVATVFSFGIYLFWWYYNQMTDPNRHFEGNWLQEDAVVAAIRALRDPAQPPPLSERGI*
Ga0116221_113211223300009523Peatlands SoilFIAFILLDQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYHDQMIVPNVHFQTNWVQEDSLAAAVHALR*
Ga0116220_1054587013300009525Peatlands SoilTRDFRDPVIFVVLAVVARGIIDFIAFILLDQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYYDQMIVPNVHFQTNWVQEDSLAAAVHALR
Ga0116136_103330733300009547PeatlandLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG*
Ga0116137_121242923300009549PeatlandVLLDQDLVKHDRSEVGVEYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATIFSLGIYLFWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR*
Ga0116103_111648123300009615PeatlandYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATIFSLGIYLLWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR*
Ga0116111_100311423300009616PeatlandLDQDIVRHDRSEVGVEYELALIFWRLGQPLSVPDQTRVKMQNNYVGRIVATIVSFGIYLLWWYYDQMIEPNLHFRTNWAQEDALVAAVQALR*
Ga0116114_117603013300009630PeatlandRGIVEIIAFVLLDQDLVKHDRSEVGVEYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR*
Ga0116118_113400113300009637PeatlandKAFREPVIWVVLAVLARGIVELIAFILLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG*
Ga0116132_114862713300009646PeatlandIWVVLAVVARGIVELIAFILLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG*
Ga0116224_1002840813300009683Peatlands SoilVLRSMTSDFRDPVIWLVLSIIVRGLVEIIAFILLDQDLTKHDRAEVGIEYELAVIFGRFGREQPQPDQTRVKVPNNYVGRIVATVFSFGLYLFWWYYNQMIVPNVHFQANWVQEDTLAAAVQALC*
Ga0116224_1014469613300009683Peatlands SoilQRAAAHMDVLRRMTRDFRDPVIFVVLAVVARGIIDFIAFILLDQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYHDQMIVPNVHFQTNWVQEDSLAAAVHALR*
Ga0116216_1024797923300009698Peatlands SoilIIAFILLDQDLTKHDRAEVGIEYELAVIFGRFGREQPQPDQTRVKVPNNYVGRIVASIFSLGVYLFWWYYNQMDDPNRHFQTNWPQEDALAAAVASLR*
Ga0116219_1019392633300009824Peatlands SoilAGHVAVLRQMTGDFRDPTIWLVLSIVARGIVDIVLFVLLDQDLVKHDRAEVGVEYELSLIYGRLGHQLPAPDQGRVKGNNNYVGRIVATIASFGIYSFWWFYNQMDEPNRHFKTNWAQEDSLAVAVNTLR*
Ga0116219_1082337123300009824Peatlands SoilVLLDQDLVKHDRSEVGVEYELALIFGRFGHPLPAPDQARVKAQDNYVGRIVATVFSLGIYLLWWYYNQMDGPNRHFQGNWAQEDTLVAAVQAVR*
Ga0074045_1036009113300010341Bog Forest SoilLALAWEQAGRRGLQAELTPSFQRASAHLDVLQRMEEAFREPVIWVVLTVVARGIVEIIAFILLDQDLVNHDRSEVGVEYELALIFRHLGQPLPVPDQTRLKGRDNYVGRIVATITSLGIYLFWWYHDQMIKPNLHFRANWAEEDALIAAVQALG*
Ga0074044_1076679123300010343Bog Forest SoilFREPVIWVVLTVVARGIVEIIAFILLDQDLVNHDRSEVGVEYELALIFRHLGQPLPVPDQTRLKGRDNYVGRIVATITSLGIYLFWWYHDQMIKPNLHFRANWAEEDALIAAVQALG*
Ga0136449_10312657913300010379Peatlands SoilPVIWVVLAIVARGVAEIVAFVLLDQDLIKHDRAEVGVEYELSLIYGRLGQHVRSPDQDRVKGPDNYVGRIVAAVFSFGIYMFWWYYNQMQVPNQHFAGNWAQEDELARAVEAIS*
Ga0126350_1121141163300010880Boreal Forest SoilPGDFREPVIWLILAIVARGIVEIIAFVLLAQDLVKHDRSEVGVEYELSLIFGRLGQTVPAPDQGRVKGQNNYVGRIIATVFSLGIYLFWWYYNQMEDPNHHFRTNWAQEDALAAAANGLRS*
Ga0137359_1108072613300012923Vadose Zone SoilDFREPVIWLVLAVVARGIIEIVAFVLLDQDLVRHDRAEVGVEYEISLIYAALGQQVPLPDQSRVKAPDNYVGRILATIFSFGIYMFWWYYNQMDVPNAHFRDNWPAEDALLRGVEGLA*
Ga0181518_1034622823300014156BogLLDQDLVKHDRSEVAVEIELSVIFGRLGQALPAPDQTRLKSQNNYVGRIVATIFSLGLYLFWWYYDQMIGPNLHFQANWTQEDALVAAVQALR*
Ga0181521_1021818433300014158BogLDQDLVKHDRAEVGVEYEMSLIFGRLGQAVPAPDQARVKGQNNYIGRIVATVFSLSIYLFWWYYNQMNDPNRHFETNWLQEDAVAAAVRALREPA*
Ga0181521_1022651723300014158BogFRDPVIWVVLAVVARGIVEFIAFILLDQDLVKHDRSEVAVEIELSVIFGRLGQALPAPDQTRLKSQNNYVGRIVATIFSLGLYLFWWYYDQMIGPNLHFQANWTQEDALVAAVQALR*
Ga0181521_1053077013300014158BogMTGDFRDPVIWLVLAVVARGIVEIIAFVLLDKDLVRHDGAEVGVEYELSLIFRRFGQAVPEPNQNRIKGEDNYVGRIVATVFSFGIYLFWWYYNQMTDPNRHFEGNWLQEDAVVAAIRALRDPAQPPPLSERGI*
Ga0181521_1060603513300014158BogVLAVVARGIVELIAFILLDQDLVTHDRSEVGVEYELALIFSRLGQRLPTPDQTRVKARNNYVGRIVATIVTFGIYLLWWYYDQMSGPNLHFRTNWAQEDALVAAVQALR*
Ga0181532_1024345013300014164BogELALIFRHLGQPLPVPDQTRLKGRDNYVGRIVATITSLGIYLFWWYHDQMIKPNLHFRANWAEEDALIAAVQALG*
Ga0181532_1054738213300014164BogIWVVLAVVARGIVELIAFILLDQDLVTHDRSEVGVEYELALIFSRLGQRLPTPDQTRVKARNNYVGRIVATIVTFGIYLLWWYYDQMSGPNLHFRTNWAQEDALAAAVQALR*
Ga0181523_1064559313300014165BogRGLQAELTPSFQRASAHLDVLQRMEEAFREPVIWVVLTVVARGIVEIIAFILLDQDLVNHDRSEVGVEYELALIFRHLGQPLPVPDQTRLKGRDNYVGRIVATITSLGIYLFWWYHDQMIKPNLHFRANWAEEDALIAAVQALG*
Ga0181526_1064612113300014200BogRRMTESFREPVIWVVLAVVARGIVELIAFILLDQDLVTHDRSEVGVEYELALIFWRLGRPLPAPDQARVKGQNSYVGRIVATIVSFGIYLLWWYYDQMSGPNLHFRTNWAQEDALAAAVQALR*
Ga0181522_1101675713300014657BogEYELSVIFERFGQAVPAPDQGRAKGQDNYVGRIIATIVSLGIYLFWWYYNQMIDPNRHFQTNWVQEDALIAAASALR*
Ga0182030_1087980123300014838BogMKTDFRDPVVWLVLAIVARGIIEIVAFVLLDQDLVKHDRAEVGVEYELSLIFGRLGQALPAPDQGRVKAEDNYVGRIVATIFSFGVYLFWWYSNQMNGPNRHFEVNWAQEDALVAAVQALR*
Ga0182035_1061939313300016341SoilFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0182032_1110526113300016357SoilDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0182040_1122803413300016387SoilIWLVLAIIARGIVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYIGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0182037_1072522423300016404SoilLRRMTGDFREPVVWLVLAIIARGIAEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0182037_1122530223300016404SoilVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0181515_120469013300016730PeatlandRGIVDIVLFVLLDQDLVKHDRAEVGVEYELSLIYGRLGHQLPTPDQGRVKGNNNYVGRIVATIASFGIYSFWWFYNQMDEPNRHFKTNWAQEDSLAVAVNALR
Ga0187807_119941313300017926Freshwater SedimentLDQDLVKHDRAEVGVEYELSLIYGRLGQHVRYPDQDRVKGPDNYVGRVVATVFSFGIYMFWWYYDQMQVPNKHFAANWVQEDELAQAVSAIS
Ga0187877_136619723300017931PeatlandVRHDRSEVGVEYELALIFWRLGQPLSVPDQTRVKMQNNYVGRIVATIVSFGIYLLWWYYDQMIEPNLHFQANWAQEDALVAAVQALG
Ga0187848_1012216833300017935PeatlandRRMEEAFREPVIWVVLAVVARGIVELIAFILLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYIGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG
Ga0187853_1001578623300017940PeatlandVRHDRSEVGVEYELALIFWRLGQPLSVPDQTRVKMQNNYVGRIVATIVSFGIYLLWWYYDQMIEPNLHFRTNWAQEDALVAAVQALR
Ga0187853_1027915723300017940PeatlandVLSIVARGIVDIVLFVLLDQDLVKHDRAEVGVEYELSLIYGRLGHQLPAPDQGRVKGNNNYVGRIVATIASFGIYSFWWFYNQMDEPNRHFKTNWAQEDSLAVAVNTLR
Ga0187781_1072149713300017972Tropical PeatlandDLVKHDRTEVGVEYELSVIFGRFGQDVPTPNQARVKGQNNYVGRIVATVFSLGIYLFWWYYNQMTDPNRHFESNWLQEDAVVAAVRALHGPAQPPLPEEGR
Ga0187876_103925113300018003PeatlandIVELIAFILLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG
Ga0187804_1056587713300018006Freshwater SedimentNAHMDVLRRMTRDFRDPIIFVVLAVVARGIIEFIAFILLDQDLVKHDRSEVGVEYELSVIFGRFGQSMSAPDQSRVKGQNNYVGRILATVFSLGLYLFWWYYNQMTVPNVHFQTNWVQEDTLAAAVQALR
Ga0187875_1054357523300018035PeatlandSAHLDVLQRMEEAFREPVIWVVLTVVARGIVEIIAFILLDQDLVNHDRSEVGVEYELALIFRHLGQPLPVPDQTRLKGRDNYVGRIVATITSLGIYLFWWYHDQMIKPNLHFRANWAEEDALIAAVQALG
Ga0187883_1067644623300018037PeatlandVLLDQDLVKHDRAEVGVEYELSLIFGRFGYAVPLPDQARVKGENNYAGRIVATVFSLGIYLFWWYYNQMNDPNHHFQVNWQQEDFIVSAVQAIR
Ga0187855_1025498913300018038PeatlandEYELSVIFGRFGRSLPGPDQTRVKGPDNYVGRIVATVFTLGIYLFWWYYNQMDEPNRHFRANWAQEDALVAATSALY
Ga0187871_1026219723300018042PeatlandSFQRASAHMDVLRRMTRDFRDPVVFVVLAIVARGIIEFIAFVLLDQDLVKHDRSEVGVEYELSLIFGRFGQAVAAPDQARVKGQDNYVGRIVATVFTVGIYMFWWYYNQMNVPNRHFQCNWVQEDTLAGAVHALR
Ga0187890_1026699813300018044PeatlandKHDRAEVGVEYELSLIFRRFGQMVPEPDQTRIKGEDNYVGRIVATVFSFGIYLFWWYYNQMTDPNRHFEGNWLQEDAVVAAIRALRDTAQPPPLSERGI
Ga0187772_1093953913300018085Tropical PeatlandIARGIVEVIAFVLLDKDLVNHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKAENNYVGRIVATVVSLGVYLFWWYYNQMNDPNRHFEGNWIQEDAMVAAVRTLRESGPPPLSERGD
Ga0187772_1128993113300018085Tropical PeatlandQRAGAHLDVLKRMTADFRDPLIWVVLAIVARGIAEIIGFVFLDQDLAKHDRCEVGVEYELALIFGRLGQPVPPPDQTRVKGENNYAGRIVATIFSFGIYLFWWYYDQMIDPNRHFQVNWAQEDALVAAVQALS
Ga0187771_1094227013300018088Tropical PeatlandLLDQDLVKHDRAEVGVEYELSLIFGRLGRSVPAPDQARVKGQNNYVGRIVATVFSFGVYLFWWYYNQMNDPNRHFEGNWLQEEAMVAAMRGLRDAQPPVSEEGR
Ga0213875_1058874913300021388Plant RootsLAPSFERAAAHIAVLRQMTSDFRDPAIWTVLAIVARGVAELIAFVLLDQDLVKHDRAEVGVEYELALIYGRLGQHVRFPDQDRVKAPDNYVGRVVATVFTFGIYMFWWYYDQMQAPNEHFAANWVQEDELTQAVEAIS
Ga0137417_101752713300024330Vadose Zone SoilDFREPVIWLVLAVVARGIIEIVAFVLLDQDLVRHDRAEVGVEYEISLIYAALGQQVPLPDQSRVKAPDNYVGRILATIFSFGIYMFWWYYNQMDVPNAHFRDNWPAEDALLRGVEGLA
Ga0208821_103434913300025432PeatlandLDQDLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG
Ga0208850_103376713300025457Arctic Peat SoilLIEIVAFVLLDQDLVKHNYSEGGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR
Ga0208190_107212223300025473PeatlandVLAVIARGIVEIIAFVLLDQDLVKHDRSEVGVEYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR
Ga0208937_107815823300025506PeatlandLVKHDRSEVGVEYELALIFWRLGQPLPVPDQTRVKGQNNYVGRIVATIASLGIYLFWWYYDQMIEPNLHFQANWAQEDALVAAVQALG
Ga0209484_1017660813300025829Arctic Peat SoilRGLQEELTPSFQRAEAHMVTLRRMMGDFRDPGIWLVLAIVARGIIEIVAFVLLDQDLVQHDYSEVGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVATVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR
Ga0209176_1006161513300025854Arctic Peat SoilMVTLRRMMGDFRDPGIWLVLAIVARGIIEIVAFVLLDQDLVQHDYSEVGVEYELSLIFGSFGQAVPAPDQARVKGQNNYAGRIVVTVFSFGIYLFWWYYDQMNDPNRHFQTNWYQEDALVAAMQALR
Ga0209471_122489223300026318SoilIWLALAVVARGIIEIVAFVLLDQDLVTHDRAEVGVEYEISVIYTALGQQVPLPDQSRVKASDYHVGRILATIFSFGIYLFWWYYNQMDQPNAHFRANWPAEDALVRAVEALA
Ga0208044_120162413300027625Peatlands SoilYELALIFGRMGQAVIEPNQGRVKGQNNYAGRIVATVFTLGIYLFWWYHDQMVEPNRHFQTNWVQEDSLVAAVRALR
Ga0208827_109139413300027641Peatlands SoilILLDQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYHDQMIVPNVHFQTNWVQEDSLAAAVHALR
Ga0208565_110379223300027662Peatlands SoilLQVELTPSFQRAAAHMDVLRRMTRDFRDPVIFVVLAVVARGIIDFIAFILLDQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYHDQMIVPNVHFQTNWVQEDSLAAAVHALR
Ga0208565_120596013300027662Peatlands SoilRGVVEVIAFVLLDQDLVKHDRSEVGVEYELALIFGRFGHPLPAPDQARVKAQDNYVGRIVATVFSLGIYLLWWYYNQMDGPNRHFQGNWAQEDTLVAAVQAVR
Ga0209517_1001939483300027854Peatlands SoilGRRGLQAELTPSFQRASAHMDVLRRMTRDFRDPVIFVVLAVVARGIVEFIAFILLDQDLVKHDRSEVGVEYELAVMFGRFGQTVSAPDQARVKGQNNYVGRIVATVFSLGIYLFWWYYDQMIVPNLHFQTNWVQEDSLAVAVHALR
Ga0209517_1036814923300027854Peatlands SoilGVEYELSLIFGRFGHAVPEPDQTRVKGQNNYVGRIVASIFSLGIYLFWWYYNQMNDPNRHFELNWAQEDALVAAVQALS
Ga0209517_1042859423300027854Peatlands SoilEYELALIFGRMGQAVIEPNQGRVKGQNNYAGRIVATVFTLGIYLFWWYHDQMVEPNRHFQTNWVQEDSLVAAVRALR
Ga0255359_12159613300028060SoilEYELSLIFGRFGQYLPVPDQSRVKGQNNYVGRIVATIFSLGIYLFWWYYNQMNDPNRHFQVNWPQEDALMAAVQQALR
Ga0308309_1185054223300028906SoilRSEVGVEYELSLIFGRLGQAVPAPDQDRVKGQNNYVGRILATIFSLGIYLFWWYYNQMNDPNHHFRTNWAQEDALVAAANGLRA
Ga0310037_1038516323300030494Peatlands SoilIIAFILLDQDLTKHDRAEVGIEYELAVIFGRFGREQPQPDQTRVKVPNNYVGRIVASIFSLGVYLFWWYYNQMDDPNRHFQTNWPQEDALAAAVASLR
Ga0310039_1012655813300030706Peatlands SoilTIWLVLSIVARGIVDIVLFVLLDQDLVKHDRAEVGVEYELSLIYGRLGHQLPAPDQGRVKGNNNYVGRIVATIASFGIYSFWWFYNQMDEPNRHFKTNWAQEDSLAVAVNTLR
Ga0302325_1156760613300031234PalsaEYELALIYGRLGQALPAPDQSRVKGKNNYVGRVIAAIVSFGIYTFWWFYNQMEEPNRHFKTNWEQEDHLAAAVNTLR
Ga0318534_1075738513300031544SoilTGDFREPLIWLVLAVMARGSVEIGAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFECNWVQEDAMVAAVRALRGPSQPPLLEEGG
Ga0318555_1030428023300031640SoilKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMDDPNRHFETNWVQEDAMVAAVHALCAPAQPPPPLGEGGVNPA
Ga0307373_1058053313300031672SoilDLVKHDRSEVGVEFELALIFGRLGQAVPAPDQARVKGQNNYVGRLVATIVSVGVYLFWWYYNQMDEPNRHFQTNWAQEDALAAAVQALR
Ga0318574_1026377723300031680SoilIIARGIVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0306918_1030841523300031744SoilKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0318567_1062129413300031821SoilAIIARGIVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0310917_1114216613300031833SoilAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0318512_1046102613300031846SoilAHMDVLRRMTKDFRDPVVWLVLAIIARGIVEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0318551_1085194813300031896SoilLAIIARGIAEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0318520_1097861613300031897SoilAIIARGIVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLDQSVPMPDQSRVKGENNYVGRIVATIFSLGIYLFWWYYNQMNDPNRHFKINWVQEDAMVAAVGALRGSAQPPLSEGG
Ga0306923_1082187823300031910SoilEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0306926_1043834713300031954SoilVLRRMTKDFRDPVVWLVLAIIARGIVEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWLQEDAMVSAIRALREPAPPPLWDEGP
Ga0307479_1105547213300031962Hardwood Forest SoilEYELAAIYGHLGQPLPAPDPGRVKGQHNYVGRILASIFSVGIYLFWWYYDLMEEPNRHFATNWVQEDALAQAVQAML
Ga0306922_1052046133300032001SoilMARGSVEIGAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYIGRIVATVFSLGIYLFWWYYNQMNDPNRHFEGNWVQEDAMVAAVRALRGMAPPPLSKESR
Ga0318556_1047010813300032043SoilVLAIIARGIVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQGVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDR
Ga0318575_1015386823300032055SoilLLDQDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0318505_1030232223300032060SoilAHMDVLRRMTGDFREPVVWLVLAIIARGIAEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFESNWLQEDAMVSAIRALREPAPPRSEEGA
Ga0318553_1031836913300032068SoilIARGIAEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMDDPNRHFETNWVQEDAMVAAVHALCAPAQPPPPLGEGGVNPA
Ga0306924_1003453363300032076SoilEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFGQSVPMPDQSRVKGENNYVGRIVAAVFSLGIYLFWWYYNQMDDPNRHFQGNWVQEDAMVAAVRALCEPAPGPV
Ga0318540_1054653213300032094SoilVEVVAFVLLDKDLVKHDRAEVGVEYELSLIFGRLGQSVPMPDQSRVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFQSNWVQEDAIVAAVRALREPAQPPLSGDRG
Ga0311301_1300090913300032160Peatlands SoilQDLVRHDRSEVGVEYELAVVFGRFGQSVSAPDQARVKGQNNYVGRIVATVFSFGIYLFWWYYDQMIVPNVHFQTNWVQEDSLAAAVHALR
Ga0306920_10249045613300032261SoilVIWLVLAIIARGIVEVVAFVLLDKDLVKHDRAEVGAEYELSLIFARLGQSVPMPDQSRVKGENNYIGRIVATVFSFGIYLFWWYYNQMNDPNRHFHVNWVQEDATVAAVRALRESAPGSG
Ga0335078_1056854313300032805SoilGVEYELSLVYGRFGQTVPEPDQGRVKGEDNYVGRILATIFSLGIYAFWWYYDQMEEPNGHFQLNWAQEDALVTAVGALR
Ga0318519_1073055023300033290SoilVVWLVLAIIARGIAEIVAFVLLDKDLVKHDRAEVGVEYELSLIFGRFDQNVPMPDQARVKGENNYVGRIVATVFSLGIYLFWWYYNQMNDPNRHFETNWVQEDAMVAAVHALCAPAQPPPPLGEGGVNPA
Ga0326728_1117482813300033402Peat SoilRDPVIWLVLSLVARGVAEIVAFVLLDQDLVKHDRSEVGVEYELSLIFGRFGQRLPPPDAARVKSQDNYVGRIVATVFSFGFYQLWWYYNQMSVPNRHFSVNWSQEDALVAAVDALR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.