NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080015

Metagenome / Metatranscriptome Family F080015

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080015
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 77 residues
Representative Sequence MPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Number of Associated Samples 101
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.46 %
% of genes near scaffold ends (potentially truncated) 27.83 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.652 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(46.087 % of family members)
Environment Ontology (ENVO) Unclassified
(45.217 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.739 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.87%    β-sheet: 16.04%    Coil/Unstructured: 65.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain-liked2qdfa22qdf0.63
d.391.1.0: POlypeptide TRansport Associated (PORTRA) domain-liked6j09a26j090.63
d.391.1.0: POlypeptide TRansport Associated (PORTRA) domain-liked6j09a46j090.61
d.39.1.1: DLCd7k3ka_7k3k0.61
d.391.1.0: POlypeptide TRansport Associated (PORTRA) domain-liked4xgab24xga0.6


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF04266ASCH 4.35
PF01494FAD_binding_3 3.48
PF13662Toprim_4 1.74
PF02782FGGY_C 0.87
PF01436NHL 0.87
PF02607B12-binding_2 0.87
PF03176MMPL 0.87
PF12679ABC2_membrane_2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 6.96
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 4.35
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 4.35
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 4.35
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 3.48
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.48
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.48
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.87
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.65 %
UnclassifiedrootN/A4.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_33887_len_808_cov_56_679455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium858Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig187748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101806722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2026Open in IMG/M
3300000956|JGI10216J12902_102918939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3683Open in IMG/M
3300000956|JGI10216J12902_113983839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2852Open in IMG/M
3300001535|A3PFW1_10138389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2182Open in IMG/M
3300001537|A2065W1_11284769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium573Open in IMG/M
3300001538|A10PFW1_10086134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
3300004114|Ga0062593_101009666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium854Open in IMG/M
3300004114|Ga0062593_102774327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium559Open in IMG/M
3300004156|Ga0062589_102169556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium568Open in IMG/M
3300004157|Ga0062590_100658093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium934Open in IMG/M
3300004463|Ga0063356_103237445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300005328|Ga0070676_11271295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium561Open in IMG/M
3300005333|Ga0070677_10393609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium728Open in IMG/M
3300005355|Ga0070671_101875939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium533Open in IMG/M
3300005367|Ga0070667_102341004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300005436|Ga0070713_100413292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1262Open in IMG/M
3300005535|Ga0070684_101692635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium597Open in IMG/M
3300005548|Ga0070665_100939868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium877Open in IMG/M
3300005617|Ga0068859_101647034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium709Open in IMG/M
3300005841|Ga0068863_101027694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium827Open in IMG/M
3300005842|Ga0068858_101887223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium590Open in IMG/M
3300006575|Ga0074053_11201004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium893Open in IMG/M
3300006606|Ga0074062_12879553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1090Open in IMG/M
3300006881|Ga0068865_101393739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300009098|Ga0105245_11104266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium839Open in IMG/M
3300009156|Ga0111538_12684584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300009551|Ga0105238_11225915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium775Open in IMG/M
3300010147|Ga0126319_1073398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium668Open in IMG/M
3300010147|Ga0126319_1159537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium619Open in IMG/M
3300010147|Ga0126319_1251655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300010154|Ga0127503_10203250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300010154|Ga0127503_10352602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium612Open in IMG/M
3300010397|Ga0134124_10756654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium967Open in IMG/M
3300010399|Ga0134127_12334025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium614Open in IMG/M
3300011444|Ga0137463_1048368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1581Open in IMG/M
3300011444|Ga0137463_1343332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300012008|Ga0120174_1003679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5967Open in IMG/M
3300012019|Ga0120139_1101852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium722Open in IMG/M
3300012212|Ga0150985_105453235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1078Open in IMG/M
3300012469|Ga0150984_115368927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium595Open in IMG/M
3300012882|Ga0157304_1116561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium505Open in IMG/M
3300012883|Ga0157281_1110376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300012891|Ga0157305_10166409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium606Open in IMG/M
3300012895|Ga0157309_10352038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium513Open in IMG/M
3300012896|Ga0157303_10192005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium582Open in IMG/M
3300012897|Ga0157285_10053421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium993Open in IMG/M
3300012898|Ga0157293_10038652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1005Open in IMG/M
3300012900|Ga0157292_10408008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium516Open in IMG/M
3300012901|Ga0157288_10015614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1364Open in IMG/M
3300012903|Ga0157289_10208374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300012906|Ga0157295_10013129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1517Open in IMG/M
3300012908|Ga0157286_10257917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300012911|Ga0157301_10363976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300012911|Ga0157301_10448559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300012916|Ga0157310_10188978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium740Open in IMG/M
3300012951|Ga0164300_10676394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium621Open in IMG/M
3300012955|Ga0164298_11191173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium577Open in IMG/M
3300012957|Ga0164303_10119910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1340Open in IMG/M
3300012958|Ga0164299_10891000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium644Open in IMG/M
3300012960|Ga0164301_10514856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium866Open in IMG/M
3300012987|Ga0164307_10042753All Organisms → cellular organisms → Bacteria2548Open in IMG/M
3300013102|Ga0157371_10640660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi793Open in IMG/M
3300013501|Ga0120154_1102161All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300013503|Ga0120127_10168347Not Available532Open in IMG/M
3300014056|Ga0120125_1193900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium504Open in IMG/M
3300015077|Ga0173483_10218032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium889Open in IMG/M
3300015077|Ga0173483_10684436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium576Open in IMG/M
3300015085|Ga0167632_1000056All Organisms → cellular organisms → Bacteria25671Open in IMG/M
3300015190|Ga0167651_1008833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2295Open in IMG/M
3300015192|Ga0167646_1002752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi5908Open in IMG/M
3300015371|Ga0132258_12593688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1266Open in IMG/M
3300015371|Ga0132258_13992233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1001Open in IMG/M
3300018072|Ga0184635_10233816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300018432|Ga0190275_13476014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium510Open in IMG/M
3300018466|Ga0190268_11795913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium552Open in IMG/M
3300018469|Ga0190270_10130183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2000Open in IMG/M
3300018476|Ga0190274_12830063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium581Open in IMG/M
3300019356|Ga0173481_10234092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium817Open in IMG/M
3300019361|Ga0173482_10204443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium811Open in IMG/M
3300020005|Ga0193697_1138264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300020021|Ga0193726_1353880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300022880|Ga0247792_1153943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300022886|Ga0247746_1155333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium585Open in IMG/M
3300022898|Ga0247745_1010569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1238Open in IMG/M
3300023072|Ga0247799_1102964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium515Open in IMG/M
3300025907|Ga0207645_11031610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300025915|Ga0207693_11472679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium503Open in IMG/M
3300026088|Ga0207641_12031251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium576Open in IMG/M
3300028380|Ga0268265_10946754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium848Open in IMG/M
3300028708|Ga0307295_10071571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium913Open in IMG/M
3300028708|Ga0307295_10217185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M
3300028712|Ga0307285_10049695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1044Open in IMG/M
3300028719|Ga0307301_10254190Not Available574Open in IMG/M
3300028720|Ga0307317_10078427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1082Open in IMG/M
3300028755|Ga0307316_10077887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1139Open in IMG/M
3300028771|Ga0307320_10288233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium651Open in IMG/M
3300028790|Ga0307283_10032213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1172Open in IMG/M
3300028802|Ga0307503_10440469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium690Open in IMG/M
3300028803|Ga0307281_10002307All Organisms → cellular organisms → Bacteria5292Open in IMG/M
3300028803|Ga0307281_10044046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1384Open in IMG/M
3300028814|Ga0307302_10475422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium620Open in IMG/M
3300028819|Ga0307296_10055502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2095Open in IMG/M
3300028819|Ga0307296_10452012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium703Open in IMG/M
3300030903|Ga0308206_1103954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium640Open in IMG/M
3300031058|Ga0308189_10474080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300031091|Ga0308201_10381474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300031093|Ga0308197_10360990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300031114|Ga0308187_10390477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300031366|Ga0307506_10110679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium914Open in IMG/M
3300032180|Ga0307471_102959789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium603Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil46.09%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost6.96%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil4.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.48%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.87%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015192Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_015952002088090008SoilLSTTLVLNPREDTSFVALAEAIVAEGVDSPGELEGKLRPHYPSVVVRARELEGETFTIWYVYRDGHWIPGPAGAPKGG
KansclcFeb2_122304802124908045SoilMSTTLVVNPRDDRPFVALAESLVADGARSPDELQTRLREEYPEAVVRARELDGEAFTIWYVYRDGHWVSGAREPRGAGHGGL
INPhiseqgaiiFebDRAFT_10180672233300000364SoilMSTTLVVNPRNDTPFVALAERLVADGVRSPDDLQQRLRRQYPEAVVRARELDGEAFTIWYVYRDGHWVAGSLEQPEGG*
JGI10216J12902_10291893953300000956SoilMSTTLVVNPRHDTPFVALAEGLVADGVRSPEELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVPGYPEPPKGG*
JGI10216J12902_11398383933300000956SoilMPTTIVVNPRDDTPFVALAERLVADGARSTDDLQRQLRREYPLAVVRARELDGEAFTIWYVYRDGHWVSGSTGQPRGG*
A3PFW1_1013838913300001535PermafrostSTTLVLNPRDDVGFVARAEALASDGIDTPLELQERLRRDYPDAVVRARELTGEAFTIWYVYRDGHWIPGLAGAPEGG*
A2065W1_1128476923300001537PermafrostVSTTLVLNPRDDVGFVALAEALASDGIDSPLELQERLRRDYPDAVVRARELTGEAFTIWYVYRDGHWIPGLAGAPEGG*
A10PFW1_1008613413300001538PermafrostLVLNPRDDVRFVALAESLASDGIDSPLELQERLRRDYPDAVVRARELTGEAFTIWYVYRDGHWVPGLGGVPAGG*
Ga0062593_10100966613300004114SoilMSTTLVVNPRDDTPFVAMAERLVSDGVRSPNELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWV
Ga0062593_10277432723300004114SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAVQSEGG*
Ga0062589_10216955623300004156SoilMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQERLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSG
Ga0062590_10065809323300004157SoilMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQERLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGVRGEPQGG*
Ga0063356_10323744523300004463Arabidopsis Thaliana RhizosphereMSTTLVVNPRDDTPFVAMAERLVSDGVRSPNELQERLRREYPEAVVRARELDGEAFTIWYVYRDGH
Ga0070676_1127129513300005328Miscanthus RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0070677_1039360913300005333Miscanthus RhizosphereMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQERLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGVRGEQGG*
Ga0070671_10187593923300005355Switchgrass RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0070667_10234100423300005367Switchgrass RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHW
Ga0070713_10041329223300005436Corn, Switchgrass And Miscanthus RhizosphereMSITLVLNPRADAKFVALAEAIVADGIAAPLELQARLRQEYPGAIVRARELDGESQSIWYVYRDGHWIPAAGGPPEELHHA*
Ga0070684_10169263523300005535Corn RhizosphereMPTTIVVNPRDDTPFAALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0070665_10093986823300005548Switchgrass RhizosphereMSTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0068859_10164703413300005617Switchgrass RhizospherePTTIVVNPRDDTPFAALAEKLMADGARSTGELQDQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0068863_10102769423300005841Switchgrass RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGRQSKGG*
Ga0068858_10188722313300005842Switchgrass RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQ
Ga0074053_1120100423300006575SoilMPTTIVVNPRDDTPFVALAEKLVADGARNTGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0074062_1287955323300006606SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQAQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0068865_10139373913300006881Miscanthus RhizosphereTRERRMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGRSKGG*
Ga0105245_1110426613300009098Miscanthus RhizosphereMPTTIVVNPRDDTPFVALAEKLVTDGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0111538_1268458413300009156Populus RhizosphereMSTTLVVNPRDDTPFVAMAERLVADGVRSPNELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGVRGEPQGG*
Ga0105238_1122591533300009551Corn RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQDQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG*
Ga0126319_107339833300010147SoilTRERRMPTTIVVNPRDDTPFVAMAERLVADGARSPGELQEQLRPEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAVQSEGG*
Ga0126319_115953713300010147SoilDTRFVARAEAIVGDGIDAPYELQARLRVDYPGAIVRARELDGEAQSIWYVYRDGHWISAAAGPPEEKQRV*
Ga0126319_125165513300010147SoilAQGSGGMSATLVVNPRDDTPFVALAESLVADGVHSPDELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWVTGSRGRPKGG*
Ga0127503_1020325013300010154SoilGTRERRMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0127503_1035260213300010154SoilAVPTTLVLNPRDDARFVALAEGMVADGVESPFDLQARLRQDYPNAVVRARDLDGEALSIWYVYRDGHWTPKQIGAAEDE*
Ga0134124_1075665413300010397Terrestrial SoilERRMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0134127_1233402513300010399Terrestrial SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0137463_104836843300011444SoilMSTTLVVNPRDDTPFVALAEGLVADGVHTPDELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSEQSKGG*
Ga0137463_134333223300011444SoilMSTTLVVNPRGDTPFVALAERLVADGVHSPGELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWVTGSPEQPKGG*
Ga0120174_100367943300012008PermafrostVSTTLVLNPRDDVRFVALAESLASDGIDSPLELQERLRRDYPDAVVRARELTGEAFTIWYVYRDGHWVPGLGGVPAGG*
Ga0120139_110185223300012019PermafrostVSTTLVLNPRDDARFVALAEEIASAGTDTPLEFQERLRRDYPNAVVRARELTGEAFTIWYVYRDGHWIPSPDVQPEGG*
Ga0150985_10545323533300012212Avena Fatua RhizosphereMSTTLVVNPRDDTPFVALAERVVAEGVRSPSELQHRLRQEYPDAVVRARELDGEAFTIWYVYRDGHWVTGSREQPEGG*
Ga0150984_11536892713300012469Avena Fatua RhizosphereAQGSGAMSTTLVVNPRDDTPFVALAERVVAEGVRSPSELQHRLRQEYPDAVVRARELDGEAFTIWYVYRDGHWVTGSREQPEGG*
Ga0157304_111656123300012882SoilMPTTIVVNPRDDAPFVALAERLVGDGARSTGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157281_111037623300012883SoilMPTSIVVNPRDDMPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0157305_1016640923300012891SoilMPTTIVVNPRDDTPFAALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157309_1035203823300012895SoilMSTTIVVNPRDDTPFVALAEKLVADGARSTDELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157303_1019200513300012896SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSDGRPKGG*
Ga0157285_1005342133300012897SoilMPTTIVVNPRDDTPFAALPEKIVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157293_1003865223300012898SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTDELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157292_1040800823300012900SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG*
Ga0157288_1001561423300012901SoilMSTTIVVNPRDDTPFVALAEKLVADGARSTDELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0157289_1020837413300012903SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157295_1001312913300012906SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSEGG*
Ga0157286_1025791723300012908SoilMPTTIVVNPRDDTPFVALAEKLVADGGRSTDELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0157301_1036397613300012911SoilFVELAEKLVAGGARSTGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0157301_1044855913300012911SoilMPTTIVVNPRDDAPFVALAERLVADGVRSTGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG*
Ga0157310_1018897813300012916SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRLEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAVQSEGG*
Ga0164300_1067639413300012951SoilMPTTIVVNPRDDAPFVALAERLVDDGARSTGELQEQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0164298_1119117323300012955SoilMPTTIVVNPRDDAPFVALAERLVADGARSTGELQEELRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0164303_1011991013300012957SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSG
Ga0164299_1089100023300012958SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQGQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0164301_1051485633300012960SoilMPTTIVVNPRDDAPFVALAERLVADGARSTGELQEQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0164307_1004275333300012987SoilMPTTIVVNPRDDAPFVALAERLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0157371_1064066013300013102Corn RhizosphereDTPFVALAEKLVADGARSTGELQDQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG*
Ga0120154_110216113300013501PermafrostVALAEALASDGIDSPLELQERLRRDYPDAVVRARELTGEAFTIWYVYRDGHWIPGLAGAPEGG*
Ga0120127_1016834713300013503PermafrostVSTTLVLNPRDDARFVALAEEIASTGTDTPLQFQERLRRDYPNAVVRARELTGEAFPIWYVYR
Ga0120125_119390023300014056PermafrostVSTTLVLNPRDDARFVALAEEIASTGADTPLAFQERLRHDYPNAVVRARELTGEAFTIWYVYRDGHWIPSPDAQPEGG*
Ga0173483_1021803223300015077SoilMPTTIVVNPRDDMPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSDGRPKGG*
Ga0173483_1068443623300015077SoilMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQERLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGVRG
Ga0167632_1000056213300015085Glacier Forefield SoilLSTTLILNPRDDASFVALAEQFVSEGVATAAELQKRLQTAYPDVVVRARELTGEPFTIWYVYRDGHWISGPVGAPEGG*
Ga0167651_100883323300015190Glacier Forefield SoilMSTTLVLNPRHDPEFVTFAEAAMSAGVASPGELQEHLRHRYPHAVARARELNGEAFTIWYVYRDGHWIPGLVNAAGGG*
Ga0167646_100275253300015192Glacier Forefield SoilVSPTLVLNPRQDTDFVRLAESIVAEGIDSPGGLQERLRPTYPLAVVRARELTGEAFTIWYVYRDGHWIPGLSQAPEGG*
Ga0132258_1259368823300015371Arabidopsis RhizosphereMPTTIVVNPRDDTPFVALAESLVADGARSPDDLQRELRREDPDAVVRARELDGEAFTIWYVYRDGHWVSGSAGQPEGG*
Ga0132258_1399223323300015371Arabidopsis RhizosphereMPTTIVVNPRDDSPFVAMAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG*
Ga0184635_1023381623300018072Groundwater SedimentMSTTLVVNPRDDTPFVRLAERLVADGVRSPSELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGAEPKGG
Ga0190275_1347601413300018432SoilMSTTLVVNPRDDRPFVALAERLVADGVRSPDELQTRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGAGGEPGGG
Ga0190268_1179591313300018466SoilMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQEGLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGSGGEPKGG
Ga0190270_1013018343300018469SoilMSTTLVVNPRDDTPFVTMAERLVADGVRSPNELQERLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGVRGEAQGG
Ga0190274_1283006313300018476SoilNPRDDTPFVDLAERLVADGVRSPKELQDRLRREYPDAVVRARELDGEAFTIWYVYRDGHWVSGVRGEPQGG
Ga0173481_1023409213300019356SoilMSTTIVVNPRDDTPFVALAEKLVADGARSTDELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0173482_1020444323300019361SoilMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAVQSEGG
Ga0193697_113826423300020005SoilMSTTLVVNPRDDTPFVALAERLVADGVRSPKELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVPGSPDRPKGG
Ga0193726_135388023300020021SoilVSTTLVLNPRHDTAFVALAEALAMDGVGTPAELEARLRAHYPNVLVRARELADEPFTMWYVYRDGHWVPAPPRDRAGGSS
Ga0247792_115394313300022880SoilMSTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSSGQSKGG
Ga0247746_115533323300022886SoilMPTTIVVNPRDDTPFAALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0247745_101056933300022898SoilMPTTIVVNPRDDTPFVALAERLVADGARSPGELQQQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAVQSEGG
Ga0247799_110296413300023072SoilMPTTLVVNPRDDSPFVALAERLVADGVHSPAELQARLRQEYPETVVRARELDGEAFSIWYVYRDGHWVSASREGPKGG
Ga0207645_1103161023300025907Miscanthus RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0207693_1147267913300025915Corn, Switchgrass And Miscanthus RhizosphereAPVSITLVLNPRTDPKFVALAEAIVADGVAEPLELQARLRQEYPAAIVRARELDGEAQSVWYVYRDGHWIPAAGGPPEELHHA
Ga0207641_1203125113300026088Switchgrass RhizosphereMPTTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGRQSKGG
Ga0268265_1094675433300028380Switchgrass RhizosphereMPRTIVVNPRDDTPFVALAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0307295_1007157113300028708SoilMSTTLVVNPREDTPFVTLAERLVADGVRSPDELQDRLRREYPEAVVRARELDGEAFTIWYVYRDGHWVTGSPERPKGG
Ga0307295_1021718523300028708SoilMPTTLVVNPRDDTPFVALAERLVADGVRSPAELQERLRPEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0307285_1004969523300028712SoilMPTTIVVNPRDDAPFVALAERLVADGVRSTGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG
Ga0307301_1025419023300028719SoilVAPTLILNPRNDARFVAVAEAIVSEGVASPGKLQERLRRDYPEVVVRPRELTGEVLTVWYVYRDGYWTSSPEGTQKEADGV
Ga0307317_1007842733300028720SoilMPTTLVVNPRDDTPFVALAERLVADGVRSPAELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSAAPPEGG
Ga0307316_1007788723300028755SoilMSTTLVVNPREDTPFVTLAERLVADGVRSPDELQDRLRREYPEAVVRARDLDGEAFTIWYVYRDGHWITGSQEQPKGG
Ga0307320_1026315433300028771SoilVLAPTLILNPRHDGRFVAVAEATVSDGVSSPQELQARLRPQYPQVVVRARELTGEAFTIWYVYRDGHWVSSQEGHDKDG
Ga0307320_1028823323300028771SoilMSTTLVVNPRDDTPFVALAERLVADGVRSPDELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSPDRPKGG
Ga0307283_1003221323300028790SoilVALAERLVADGVRSTGELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG
Ga0307503_1044046913300028802SoilMPTTIVVNPRDDTPFVVLAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0307281_1000230743300028803SoilMSTTLVVNPRDDTPFVALAERLVADGVRSPNELQARLRREYPDAVVRARELDGEAFTIWYVYRDGHWVTGSPKHPKGG
Ga0307281_1004404623300028803SoilMSTTLVVNPRDDTPFVALAERLVADGARSPDELQARLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSKGQPKGG
Ga0307281_1013180323300028803SoilVPITLVLNPRDDPPFVGLAEAIVTEGIGAPAELQTRLRQAYPNAIVRARELDGEAQSIWYVYRDGHWIPAERGGARETDGG
Ga0307302_1047542223300028814SoilMSTTLVVNPRGDTPFVALAERLVADGVRSPDELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSPERPKGG
Ga0307296_1005550243300028819SoilMSTTLVVNPRSDTPFVGLAERLMADGVRSPEDLQQRLRREYPEAVVRARELDGEAFTIWYVYRDGHWITGSREQPEGG
Ga0307296_1045201223300028819SoilMPTTIVVNPRDDTPFVAMAERLVADGVRSTDELQQQLRREYPDAVVRARELDGEAFTIWYVYRDGHWVPGSGEQSKGG
Ga0308206_110395413300030903SoilRTQGSGVMSTTLVVNPRDDTPFVALAERLVADGVRSPDELQDRLRQEYPEAVVRARELDGEAFTIWYVYRDGHWVSGSPDRPKGG
Ga0308189_1047408013300031058SoilRKGSGGMSTTLVVNPREDTPFVTLAERLVADGVRSPDELQDRLRREYPEAVVRARDLDGEAFTIWYVYRDGHWITGSQEQPKGG
Ga0308201_1038147413300031091SoilSGGMSTTLVVNPREDTPFVTLAERLVADGVRSPDELQDRLRREYPEAVVRARDLDGEAFTIWYVYRDGHWITGSQEQPKGG
Ga0308197_1036099013300031093SoilEDTPFVTLAERLVADGVRSPDELQDRLRREYPEAVVRARDLDGEAFTIWYVYRDGHWITGSQEQPKGG
Ga0308187_1039047713300031114SoilCNLSRGGLDVGRVRAQGSGGMSTTLVVNPRDDTPFVALAEGLVADGVRSPSELQERLRREYPEAVVRARELDGEAFTIWYVYRDGHWVTGSPERPKGG
Ga0307506_1011067923300031366SoilMPTTIVVNPRDDTPFVAFAEKLVADGARSTGELQEQLRREYPEAVVRARELDGEAFTIWYVYRDGHWVSGSGGQSKGG
Ga0307471_10295978923300032180Hardwood Forest SoilMPITLVLNPRADPKFVALAEGIVAGGVATPVEMQARLRQDYPGAIVRARELDGEAQSIWYVYRDGHWIPAAERPPQELHHA
Ga0364945_0104485_581_8173300034115SedimentMAPTLILNPRQDARFVTAAEALIADGVESPRELQERLREHYPEVVVRPRELTGESFAVWYVYRDGHWISSPEGSKPGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.