NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079984

Metagenome / Metatranscriptome Family F079984

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079984
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 37 residues
Representative Sequence LNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEKG
Number of Associated Samples 92
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.52 %
% of genes near scaffold ends (potentially truncated) 22.61 %
% of genes from short scaffolds (< 2000 bps) 88.70 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.696 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.478 % of family members)
Environment Ontology (ENVO) Unclassified
(22.609 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.94%    β-sheet: 0.00%    Coil/Unstructured: 56.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF05598DUF772 68.70
PF00188CAP 0.87
PF01436NHL 0.87
PF14833NAD_binding_11 0.87
PF03050DDE_Tnp_IS66 0.87
PF13580SIS_2 0.87
PF00118Cpn60_TCP1 0.87
PF13490zf-HC2 0.87
PF04368DUF507 0.87
PF13174TPR_6 0.87
PF04389Peptidase_M28 0.87
PF07969Amidohydro_3 0.87
PF00158Sigma54_activat 0.87
PF00408PGM_PMM_IV 0.87
PF02897Peptidase_S9_N 0.87
PF00905Transpeptidase 0.87
PF00857Isochorismatase 0.87
PF09832DUF2059 0.87
PF00717Peptidase_S24 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.87
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.87
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.87
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.87
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 0.87
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG1770Protease IIAmino acid transport and metabolism [E] 0.87
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.87
COG3436TransposaseMobilome: prophages, transposons [X] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.70 %
UnclassifiedrootN/A11.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001182|JGI12668J13544_1009165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37540Open in IMG/M
3300001593|JGI12635J15846_10520225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37700Open in IMG/M
3300005538|Ga0070731_10017408All Organisms → cellular organisms → Bacteria → Proteobacteria5054Open in IMG/M
3300005538|Ga0070731_10134351All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300005541|Ga0070733_10109378All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300005541|Ga0070733_10712950All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005541|Ga0070733_11002401All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005542|Ga0070732_10143639All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300005542|Ga0070732_10724635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37606Open in IMG/M
3300005591|Ga0070761_10183515All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300005591|Ga0070761_10561626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37708Open in IMG/M
3300006050|Ga0075028_100257805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria959Open in IMG/M
3300006162|Ga0075030_101066697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37636Open in IMG/M
3300006162|Ga0075030_101429927Not Available542Open in IMG/M
3300006638|Ga0075522_10473219Not Available583Open in IMG/M
3300007255|Ga0099791_10278837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37795Open in IMG/M
3300007265|Ga0099794_10041888All Organisms → cellular organisms → Bacteria → Proteobacteria2181Open in IMG/M
3300007265|Ga0099794_10318198All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300007265|Ga0099794_10662639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37555Open in IMG/M
3300009090|Ga0099827_11547723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37577Open in IMG/M
3300009143|Ga0099792_10495174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37764Open in IMG/M
3300009645|Ga0116106_1064682All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300009762|Ga0116130_1130634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37790Open in IMG/M
3300010396|Ga0134126_11057947All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300011270|Ga0137391_10725611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37824Open in IMG/M
3300011271|Ga0137393_10709614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37861Open in IMG/M
3300012189|Ga0137388_11680388All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012205|Ga0137362_11282359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37618Open in IMG/M
3300012210|Ga0137378_10206716All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300012363|Ga0137390_11036319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37771Open in IMG/M
3300012582|Ga0137358_10470002Not Available848Open in IMG/M
3300012683|Ga0137398_10107394All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300012683|Ga0137398_11204149Not Available517Open in IMG/M
3300012917|Ga0137395_10066959All Organisms → cellular organisms → Bacteria → Proteobacteria2308Open in IMG/M
3300012917|Ga0137395_10150197All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae1595Open in IMG/M
3300012917|Ga0137395_10384868Not Available1003Open in IMG/M
3300012925|Ga0137419_10344084Not Available1152Open in IMG/M
3300012930|Ga0137407_12097468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37540Open in IMG/M
3300012944|Ga0137410_10223383All Organisms → cellular organisms → Bacteria → Proteobacteria1467Open in IMG/M
3300014164|Ga0181532_10302090Not Available906Open in IMG/M
3300014489|Ga0182018_10084862All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300014489|Ga0182018_10664093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37544Open in IMG/M
3300014501|Ga0182024_12005394All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300014654|Ga0181525_10081116All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1805Open in IMG/M
3300014657|Ga0181522_11070672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia501Open in IMG/M
3300017927|Ga0187824_10171485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37727Open in IMG/M
3300017930|Ga0187825_10319703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37582Open in IMG/M
3300017946|Ga0187879_10150336All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300017995|Ga0187816_10208472Not Available850Open in IMG/M
3300018035|Ga0187875_10309694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium853Open in IMG/M
3300018042|Ga0187871_10618183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales601Open in IMG/M
3300018044|Ga0187890_10067565All Organisms → cellular organisms → Bacteria → Proteobacteria2105Open in IMG/M
3300020579|Ga0210407_10992764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37640Open in IMG/M
3300020579|Ga0210407_11288263All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300020580|Ga0210403_11475637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37512Open in IMG/M
3300020581|Ga0210399_10786219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37778Open in IMG/M
3300021086|Ga0179596_10414481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37680Open in IMG/M
3300021086|Ga0179596_10651035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37534Open in IMG/M
3300021168|Ga0210406_10011444All Organisms → cellular organisms → Bacteria8656Open in IMG/M
3300021168|Ga0210406_10317352All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300021170|Ga0210400_10005203All Organisms → cellular organisms → Bacteria11088Open in IMG/M
3300021178|Ga0210408_10481422Not Available987Open in IMG/M
3300021180|Ga0210396_10636080All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300021401|Ga0210393_10223623All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300021406|Ga0210386_10544051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1004Open in IMG/M
3300021432|Ga0210384_10824261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37826Open in IMG/M
3300021433|Ga0210391_10202643All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300021433|Ga0210391_10574714All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300021479|Ga0210410_10015379All Organisms → cellular organisms → Bacteria6601Open in IMG/M
3300021559|Ga0210409_10901368Not Available758Open in IMG/M
3300024227|Ga0228598_1002275All Organisms → cellular organisms → Bacteria4202Open in IMG/M
3300025500|Ga0208686_1081826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37705Open in IMG/M
3300025862|Ga0209483_1383227Not Available508Open in IMG/M
3300025898|Ga0207692_10236720All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300025916|Ga0207663_10723339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37789Open in IMG/M
3300025922|Ga0207646_11053043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37717Open in IMG/M
3300025929|Ga0207664_11825152All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300026557|Ga0179587_10081205All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1928Open in IMG/M
3300026557|Ga0179587_10171368All Organisms → cellular organisms → Bacteria → Acidobacteria1362Open in IMG/M
3300027047|Ga0208730_1028030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37649Open in IMG/M
3300027635|Ga0209625_1018355All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300027645|Ga0209117_1040287All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300027684|Ga0209626_1012601All Organisms → cellular organisms → Bacteria → Proteobacteria1952Open in IMG/M
3300027842|Ga0209580_10190275Not Available1016Open in IMG/M
3300027842|Ga0209580_10684231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37507Open in IMG/M
3300027853|Ga0209274_10375332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300027867|Ga0209167_10175941All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300027869|Ga0209579_10015339All Organisms → cellular organisms → Bacteria → Proteobacteria4467Open in IMG/M
3300027869|Ga0209579_10239608All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300027869|Ga0209579_10613940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300027903|Ga0209488_10032887All Organisms → cellular organisms → Bacteria3781Open in IMG/M
3300027908|Ga0209006_11486178All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027911|Ga0209698_10125293All Organisms → cellular organisms → Bacteria → Proteobacteria2125Open in IMG/M
3300028536|Ga0137415_10195871All Organisms → cellular organisms → Bacteria → Proteobacteria1841Open in IMG/M
3300028577|Ga0265318_10047255All Organisms → cellular organisms → Bacteria → Proteobacteria1623Open in IMG/M
3300029636|Ga0222749_10111156All Organisms → cellular organisms → Bacteria → Proteobacteria1298Open in IMG/M
3300029882|Ga0311368_10264707All Organisms → cellular organisms → Bacteria → Proteobacteria1321Open in IMG/M
3300030580|Ga0311355_10344033All Organisms → cellular organisms → Bacteria → Proteobacteria1480Open in IMG/M
3300031057|Ga0170834_103045147All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300031231|Ga0170824_111670659All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300031234|Ga0302325_11155814All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300031236|Ga0302324_100768044All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300031446|Ga0170820_11533787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37556Open in IMG/M
3300031524|Ga0302320_11364346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37709Open in IMG/M
3300031708|Ga0310686_103749463Not Available648Open in IMG/M
3300031708|Ga0310686_112681479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37565Open in IMG/M
3300031708|Ga0310686_118524225All Organisms → cellular organisms → Bacteria8815Open in IMG/M
3300031715|Ga0307476_10071606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2405Open in IMG/M
3300031720|Ga0307469_10181434All Organisms → cellular organisms → Bacteria → Proteobacteria1619Open in IMG/M
3300031754|Ga0307475_11584111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 43-37501Open in IMG/M
3300031962|Ga0307479_10295476All Organisms → cellular organisms → Bacteria → Proteobacteria1601Open in IMG/M
3300031962|Ga0307479_11646261All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300032770|Ga0335085_10409447All Organisms → cellular organisms → Bacteria → Proteobacteria1571Open in IMG/M
3300032955|Ga0335076_10285180All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300033004|Ga0335084_10257967All Organisms → cellular organisms → Bacteria → Proteobacteria1805Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil11.30%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.35%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.74%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.87%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001182Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12668J13544_100916513300001182Forest SoilLNKIAFLHAIVVDFCVQRLQGFGVVSAEILQFYLEEKG*
JGI12635J15846_1052022513300001593Forest SoilLDKIAFLRAIIVDFCVERLQGFGVVSAEILQFYFGEKG*
Ga0070731_1001740863300005538Surface SoilLNKIAFLYAIVVDFSVERFQGFGMLSAEILQFYFEEKG*
Ga0070731_1013435123300005538Surface SoilLDKAAFFLSIFIYFYLERLQGFGMLSAEILQFYFGEQG*
Ga0070733_1010937823300005541Surface SoilLDKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYFGEQG*
Ga0070733_1071295023300005541Surface SoilLNKSAFFLSIFIDFYLEKLQGFGMLSAEILQFYFGEQG*
Ga0070733_1100240123300005541Surface SoilLNKVAFLGVIVVDFYVEKLQGFGMLSAETLQFYFGEKG*
Ga0070732_1014363923300005542Surface SoilLNKIAFFRAIVVDFCVEKLQGFGMVSAETLQFYFGEQG*
Ga0070732_1072463523300005542Surface SoilLNKSAFFLSIFVDFYLEKLQGFGMLSAEILQFYFGEQG*
Ga0070761_1018351523300005591SoilLNKFAFFLSIVVDFSVEKLQGFGMLSAEILQFYFGEKG*
Ga0070761_1056162613300005591SoilLNKIAFLHAIVVDFCWEKLQGFGVVSAEILQFYFGDKG*
Ga0075028_10025780523300006050WatershedsLNKSAFSVSIVVDFYLEKLQGFGRLSAEILQFYFGEQG*
Ga0075030_10106669723300006162WatershedsLDKAAFFLSIVVDFYLERLQGFGMLSAEILQFYFGEKG*
Ga0075030_10142992723300006162WatershedsLIKSLFLHAIVVDFFVERLQGFGMESAEILQFYFGEQG*
Ga0075522_1047321923300006638Arctic Peat SoilLNKTAFLLAIVVDFCVEKLQGFGMLSAKILQFYFGEKG*
Ga0099791_1027883723300007255Vadose Zone SoilLNKTAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG*
Ga0099794_1004188823300007265Vadose Zone SoilLNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG*
Ga0099794_1031819823300007265Vadose Zone SoilLNKISFLDAIVVDFSVERLQGFGMVSAEILQFYFGEQG*
Ga0099794_1066263923300007265Vadose Zone SoilKISFLDAIVVDFSVERLQGFGMVSAEILQFYFGEKG*
Ga0099827_1154772323300009090Vadose Zone SoilLNKSAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG*
Ga0099792_1049517423300009143Vadose Zone SoilLNKIAFLRAIVVDFCAEKLQGFGVVSAEILQFYFGEKG*
Ga0116106_106468223300009645PeatlandLNKIAILRVIVVDFCVERLQGFGVVSAEILQFYFGEKE*
Ga0116130_113063423300009762PeatlandLNKVAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE*
Ga0134126_1105794723300010396Terrestrial SoilLNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGEKG*
Ga0137391_1072561123300011270Vadose Zone SoilLNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEKG*
Ga0137393_1070961423300011271Vadose Zone SoilLNKIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEQG*
Ga0137388_1168038823300012189Vadose Zone SoilLNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYFGEQG*
Ga0137362_1128235923300012205Vadose Zone SoilLNKTAFLQAIVVDFCVEKLQGFGVLSAEILQFYWGEKG*
Ga0137378_1020671623300012210Vadose Zone SoilLNEIAFLHAIVVDFCVERLQGFGMVSAEILQFYFGEQG*
Ga0137390_1103631923300012363Vadose Zone SoilLNKAVFLLSIFVDFCLERLQGFGMESAEILQFYLGEKG*
Ga0137358_1047000213300012582Vadose Zone SoilKIAFLRGIVVDFCAEKLQGFGVVSAEILQFYFGEKG*
Ga0137398_1010739433300012683Vadose Zone SoilLNKIAFLHVIVVDFCDERLQGFGMVSAEILQFYFGE*
Ga0137398_1120414913300012683Vadose Zone SoilLNKIAFLHVIVVDFCDERLQGFGMVSAEILQFYFG
Ga0137395_1006695933300012917Vadose Zone SoilLNKIAFLPAIVVDFCAEKLQGFGVVSAEILEFYFGEKG*
Ga0137395_1015019713300012917Vadose Zone SoilLNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYFG
Ga0137395_1038486823300012917Vadose Zone SoilMNKIAFLQAIVVDFCVEKLQGFGVLSAEILQFYLGEKG*
Ga0137419_1034408423300012925Vadose Zone SoilLNKIAFLHAIVVDFCMEKLQGFGVLSAEILQFYLGEKG*
Ga0137407_1209746823300012930Vadose Zone SoilLNKISFLQAIVVDFCVKKLQGFGVLSAEILQFYLGEKG*
Ga0137410_1022338313300012944Vadose Zone SoilAFLHTISVDFCVERLQGFGVRSAEILQFYFGEKG*
Ga0181532_1030209023300014164BogLNNIAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE*
Ga0182018_1008486233300014489PalsaVNKIAFLHAIVIDFCVERLQGFSVVSAEILQFFF*
Ga0182018_1066409323300014489PalsaLNKIAFLRAIVVDFCGEKLQGFGMESAEILQFYFGEKG*
Ga0182024_1200539423300014501PermafrostLNKFAFFLSIFVDFCVERLQGFGMMSAEILQFYFGEQG*
Ga0181525_1008111633300014654BogLHKIAFLLSIFIDFCVGKLQGFGMVDAEILQFYFRENG*
Ga0181522_1107067223300014657BogLNKFAFLHAIVVDFCAERLQGFGMWSAEILQFYFG
Ga0187824_1017148523300017927Freshwater SedimentLNKIAFLHAIFVDFCVEKLQGFGVLSAEILQFYFGEKG
Ga0187825_1031970323300017930Freshwater SedimentLNKIVFLLAIFVDFCVERLQGFDVLSAEILQFYLGEKG
Ga0187879_1015033613300017946PeatlandLNKVAFLQAIVVDFCVERLQGFGVESAEILQFYFGEKE
Ga0187816_1020847213300017995Freshwater SedimentIVFLLAIFLDFCLERLQGFGVVSAEILQFYFGEKG
Ga0187875_1030969433300018035PeatlandLNKVAFLQAIVVDFCVERLQGFGVESAEILQFYFGEKG
Ga0187871_1061818323300018042PeatlandLNKFAFLHAIVVDFCVERLQGFGMMSAEILQFYFGEQG
Ga0187890_1006756533300018044PeatlandLNKVAFLQAIVVDFCVERLQGFGVVSAEILQFYFGEKE
Ga0210407_1099276423300020579SoilLNKFVFLRAIVVDFCAQRLQGFGVVSAEILQFYFGEQG
Ga0210407_1128826323300020579SoilLNKFAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQG
Ga0210403_1147563723300020580SoilLNKIAFLRAIVVDFCVERLQGFDVVSAEILQFYFGEKG
Ga0210399_1078621923300020581SoilLNKILFLHAIVVDFPVKSLQGFGMVNAEILQFYFGEQG
Ga0179596_1041448113300021086Vadose Zone SoilLNKIAFLRAIVVDFCVEKLQGFGMVSAEILQFYFGEQG
Ga0179596_1065103523300021086Vadose Zone SoilLNKAVFLLSIFVDFCLERLQGFGMESAEILQFYLGEKG
Ga0210406_1001144463300021168SoilLNEIAFLHPIVVDFCVEKLRGFGVVSAETLQFYFGEQG
Ga0210406_1031735223300021168SoilLNKFVFLRAIVVDFCAQRLQGFGVVSAEILQFYFGE
Ga0210400_1000520333300021170SoilLNEIAFLHPIVVDFCVEKLRGFGVVSAETLQFYFGEQR
Ga0210408_1048142213300021178SoilNKSAFVLSIFVDFCVERLQGFGRMSAEILQFYFGEQG
Ga0210396_1063608023300021180SoilLNKAAFFLSIFVDFYLQRLQGFGMLNAEILQFYFGEKG
Ga0210393_1022362323300021401SoilLNKIAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQG
Ga0210386_1054405123300021406SoilLDKAAFFLSIFVYFYLERLQGFGMLSAEILQFYFGEQG
Ga0210384_1082426123300021432SoilLNKIAFSRAIVVDFSVERFQGFGVVSAEILQFYFGEKG
Ga0210391_1020264323300021433SoilLNKSAFLFAIVVDFSVERLQGFGMLSVEILQFYFGEKG
Ga0210391_1057471413300021433SoilLNKSAFLFAIVVDFSVERLQGFGMLSVEILQFYFGE
Ga0210410_10015379103300021479SoilLNKIAFLRAIVVDFCVERLQGFGVVSAEILQFYFGGEGMKPRPKPQD
Ga0210409_1090136813300021559SoilLNKFAFLHANVVDFCVEKLQGFGMLSAEILQFYFGEQ
Ga0228598_100227523300024227RhizosphereLNKFAFLHAIVVDFCVEKLQGFGMLSAEILQFYFGEQG
Ga0208686_108182613300025500PeatlandLNKIAILRVIVVDFCVERLQGFGVVSAEILQFYFGEKE
Ga0209483_138322723300025862Arctic Peat SoilLNKTAFLLAIVVDFCVEKLQGFGMLSAKILQFYFGEKG
Ga0207692_1023672023300025898Corn, Switchgrass And Miscanthus RhizosphereLNKFVFLRAIVVDFCEERLQGFGVVSAEILQFYFGVQG
Ga0207663_1072333923300025916Corn, Switchgrass And Miscanthus RhizosphereLNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGEKG
Ga0207646_1105304323300025922Corn, Switchgrass And Miscanthus RhizosphereLNKIAFLLTIFVDFCVEKLQGFGVLSTEILQFYFGEKG
Ga0207664_1182515223300025929Agricultural SoilLNKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYLGE
Ga0179587_1008120513300026557Vadose Zone SoilLNKIAFLHAIVVDFCVKKLQGFGVLSAEILQFYLGE
Ga0179587_1017136823300026557Vadose Zone SoilLNKIAFLQAIVVDFCVKKLQGFGVLSAEILQFYSGEKG
Ga0208730_102803013300027047Forest SoilKLNKSAFVLSIFVDFCVERLQGFGRMSAEILQFYFGEQG
Ga0209625_101835513300027635Forest SoilLNKIAFLHAIVVDFCVQRLQGFGVVSAEILQFYLEEKG
Ga0209117_104028723300027645Forest SoilLDKIAFLRAIIVDFCVERLQGFGVVSAEILQFYFGEKG
Ga0209626_101260123300027684Forest SoilLNKIAFLHAIVVDFCVLRLQGFGVVSAEILQFYLEEKG
Ga0209580_1019027523300027842Surface SoilLNKIAFSRAIVVDFCVEKLQGFGMVSAETLQFYFGEQG
Ga0209580_1068423123300027842Surface SoilLNKSAFFLSIFVDFYLEKLQGFGMLSAEILQFYFGEQG
Ga0209274_1037533223300027853SoilKLNKIAFLHAIVVDFCWEKLQGFGVVSAEILQFYFGDKG
Ga0209167_1017594123300027867Surface SoilLDKSAFFLSIIVDFYLEKLQGFGMWSAEILQFYFGEQG
Ga0209579_1001533913300027869Surface SoilLNKIAFLYAIVVDFSVERLQGFGMLSAEILQFYFGE
Ga0209579_1023960813300027869Surface SoilLDKAAFFLSIFIYFYLERLQGFGMLSAEILQFYFGEQG
Ga0209579_1061394023300027869Surface SoilLNKIAFLYAIVVDFSVERFQGFGMLSAEILQFYFEEKG
Ga0209488_1003288723300027903Vadose Zone SoilLNKIAFLRAIVVDFCAEKLQGFGVVSAEILQFYFGEKG
Ga0209006_1148617813300027908Forest SoilLNKFAFLHAIVVDFCVERLQGFGVVSAEILQFYFGEKG
Ga0209698_1012529333300027911WatershedsLIKSLFLHAIVVDFCVERLQGFDVVSAEILQFYFGEQG
Ga0137415_1019587133300028536Vadose Zone SoilLNKIAFLHAIVVDFCMEKLQGFGVLSAEILQFYFGEKG
Ga0265318_1004725523300028577RhizosphereLNKSAFLHAIAVDFCVEKLQGFGMMSAEILQFYFGEQG
Ga0222749_1011115623300029636SoilLNKFVFLRAIVVDFREGRLQGFGVMSAEILQFYFGVKG
Ga0311368_1026470723300029882PalsaIAFLQSIFIDFCVGKLQGFGIVGAEILQFYFRENG
Ga0311355_1034403313300030580PalsaIAFLLSIFIDFCVGKLQGFGIVGAEILQFYFRENG
Ga0170834_10304514723300031057Forest SoilLKKIAFLHAIVVDFCAERLQGFGMVSAEILQFYFGEPG
Ga0170824_11167065923300031231Forest SoilLNKFAFLHAIFVDFCVERLQGFGMMSAEILQFYFGEQG
Ga0302325_1115581413300031234PalsaLNKIAFLCAIVVDFCVERLQGFGVVSAEILQFYFGEN
Ga0302324_10076804423300031236PalsaLNKIAFSHAIVVDFCVERLQGFGVVSAEILQFYFGEKG
Ga0170820_1153378723300031446Forest SoilLNKIAFLHAIFVDFCVERLQGFGMVSAEILQFYLGEQG
Ga0302320_1136434623300031524BogISELFVVICIDFCVERLQGFGVVSAEILQFYFGENG
Ga0310686_10374946323300031708SoilLNKAAFFPSIFVDFYLWRLQGFGMLSVEILQFYFGEKG
Ga0310686_11268147913300031708SoilLNKIAFLHAIVVDICVEKLQGFGVVSAKILQFYFGGKG
Ga0310686_11852422513300031708SoilMNNFACLHAIVVDFCVERLQGFGMVSAEILQFYFGE
Ga0307476_1007160613300031715Hardwood Forest SoilLNKSAFFLSIVVDFSVERLQGFGMWSAEILQFYFGEQG
Ga0307469_1018143413300031720Hardwood Forest SoilSRVFLSIFVDFYLERLQGFGMLSAEILQFYFGEQG
Ga0307475_1158411123300031754Hardwood Forest SoilLNKIAFLRAIVVDFYVKRLQGFSMMCAEILQFYFGEQG
Ga0307479_1029547613300031962Hardwood Forest SoilLNKIAFLHAIVVDFCVQRLQGFGVVSAEILHFYFEEKG
Ga0307479_1164626113300031962Hardwood Forest SoilLNKAAFFLSIFVDFYLQRLQGFGMLNAEILQFYFGE
Ga0335085_1040944713300032770SoilNKVAFLHGIVVDFCMERLQGFGMKSAEILQFYFGEKG
Ga0335076_1028518013300032955SoilSKYAFLRAIVVDFCAGKLQGFGLIIVEILQFYFGEKG
Ga0335084_1025796713300033004SoilLNKIVFLLTIFVDFCVERLQGFGVVSVEILQFYFGEKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.