Metagenome / Metatranscriptome Family F079914

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F079914
Family Type	Metagenome / Metatranscriptome
Number of Sequences	115
Average Sequence Length	40 residues
Representative Sequence	MNVIEDIVVNLAVLVISGASAVALGHLFLSVVVKDRRSS
Number of Associated Samples	77
Number of Associated Scaffolds	115

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	79.13 %
% of genes near scaffold ends (potentially truncated)	18.26 %
% of genes from short scaffolds (< 2000 bps)	89.57 %
Associated GOLD sequencing projects	74
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (91.304 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (13.913 % of family members)
Environment Ontology (ENVO)	Unclassified (31.304 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (66.087 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 115 Family Scaffolds
PF00930	DPPIV_N	22.61
PF00005	ABC_tran	4.35
PF06537	DHOR	2.61
PF00128	Alpha-amylase	2.61
PF16657	Malt_amylase_C	2.61
PF07228	SpoIIE	1.74
PF01103	Omp85	0.87
PF00361	Proton_antipo_M	0.87
PF13633	Obsolete Pfam Family	0.87
PF12728	HTH_17	0.87
PF01370	Epimerase	0.87
PF03435	Sacchrp_dh_NADP	0.87
PF13683	rve_3	0.87

COG ID	Name	Functional Category	% Frequency in 115 Family Scaffolds
COG0823	Periplasmic component TolB of the Tol biopolymer transport system	Intracellular trafficking, secretion, and vesicular transport [U]	22.61
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	22.61
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	2.61
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	2.61
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	2.61
COG3280	Maltooligosyltrehalose synthase	Carbohydrate transport and metabolism [G]	2.61
COG3488	Uncharacterized conserved protein with two CxxC motifs, DUF1111 family	General function prediction only [R]	2.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.30 %
Unclassified	root	N/A	8.70 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.30 %
Unclassified	root	N/A	8.70 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.30 %
Unclassified	root	N/A	8.70 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	56.52 %
Unclassified	root	N/A	8.70 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	3.48 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	52.17 %
Unclassified	root	N/A	8.70 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.74 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.74 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.87 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.87 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.87 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Salinimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium	0.87 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	52.17 %
Unclassified	root	N/A	8.70 %
Salinimicrobium catena	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium catena	0.87 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.87 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459019\|G14TP7Y01CXBTX	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300000559\|F14TC_107732261	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1136	Open in IMG/M
3300003319\|soilL2_10021132	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2604	Open in IMG/M
3300004103\|Ga0058903_1476894	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	510	Open in IMG/M
3300004268\|Ga0066398_10075147	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	738	Open in IMG/M
3300004633\|Ga0066395_10827757	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557	Open in IMG/M
3300004800\|Ga0058861_11287461	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	532	Open in IMG/M
3300005171\|Ga0066677_10041869	All Organisms → cellular organisms → Bacteria	2250	Open in IMG/M
3300005176\|Ga0066679_10893266	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	560	Open in IMG/M
3300005180\|Ga0066685_10195277	All Organisms → cellular organisms → Bacteria	1387	Open in IMG/M
3300005180\|Ga0066685_10734263	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300005184\|Ga0066671_10276431	All Organisms → cellular organisms → Bacteria → Proteobacteria	1045	Open in IMG/M
3300005187\|Ga0066675_10231343	All Organisms → cellular organisms → Bacteria	1313	Open in IMG/M
3300005332\|Ga0066388_100871927	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300005332\|Ga0066388_101466716	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1191	Open in IMG/M
3300005332\|Ga0066388_102007260	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1037	Open in IMG/M
3300005332\|Ga0066388_102759741	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	897	Open in IMG/M
3300005332\|Ga0066388_102832706	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	886	Open in IMG/M
3300005332\|Ga0066388_103858875	All Organisms → cellular organisms → Bacteria → Acidobacteria	765	Open in IMG/M
3300005332\|Ga0066388_104590805	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	703	Open in IMG/M
3300005332\|Ga0066388_108278254	Not Available	519	Open in IMG/M
3300005446\|Ga0066686_10394159	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300005446\|Ga0066686_10426571	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300005451\|Ga0066681_10812048	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	564	Open in IMG/M
3300005458\|Ga0070681_10387658	All Organisms → cellular organisms → Bacteria	1308	Open in IMG/M
3300005468\|Ga0070707_101586971	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	621	Open in IMG/M
3300005529\|Ga0070741_11729659	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300005530\|Ga0070679_100410456	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300005530\|Ga0070679_100703409	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300005538\|Ga0070731_10076862	All Organisms → cellular organisms → Bacteria → Acidobacteria	2215	Open in IMG/M
3300005558\|Ga0066698_10521128	All Organisms → cellular organisms → Bacteria	807	Open in IMG/M
3300005569\|Ga0066705_10583768	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	688	Open in IMG/M
3300005587\|Ga0066654_10929161	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	501	Open in IMG/M
3300005602\|Ga0070762_11122857	Not Available	542	Open in IMG/M
3300005713\|Ga0066905_100027491	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3164	Open in IMG/M
3300005764\|Ga0066903_101453880	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1291	Open in IMG/M
3300005764\|Ga0066903_105761424	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	651	Open in IMG/M
3300005844\|Ga0068862_101819429	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	618	Open in IMG/M
3300006032\|Ga0066696_10103329	All Organisms → cellular organisms → Bacteria	1716	Open in IMG/M
3300006049\|Ga0075417_10167776	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1028	Open in IMG/M
3300006755\|Ga0079222_11060829	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	706	Open in IMG/M
3300006755\|Ga0079222_11433254	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	642	Open in IMG/M
3300006797\|Ga0066659_10228199	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300006797\|Ga0066659_10311032	All Organisms → cellular organisms → Bacteria	1206	Open in IMG/M
3300006844\|Ga0075428_100799924	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1002	Open in IMG/M
3300006845\|Ga0075421_100595217	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300006845\|Ga0075421_100678308	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1200	Open in IMG/M
3300006845\|Ga0075421_102109636	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597	Open in IMG/M
3300006854\|Ga0075425_100397176	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1588	Open in IMG/M
3300006854\|Ga0075425_100556447	Not Available	1320	Open in IMG/M
3300009012\|Ga0066710_100202226	All Organisms → cellular organisms → Bacteria → Acidobacteria	2829	Open in IMG/M
3300009012\|Ga0066710_100216580	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2742	Open in IMG/M
3300009012\|Ga0066710_101199722	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1176	Open in IMG/M
3300009012\|Ga0066710_103475186	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597	Open in IMG/M
3300009098\|Ga0105245_12693739	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	550	Open in IMG/M
3300009137\|Ga0066709_101426103	Not Available	1005	Open in IMG/M
3300009148\|Ga0105243_11489510	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	700	Open in IMG/M
3300009156\|Ga0111538_11429724	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	872	Open in IMG/M
3300009162\|Ga0075423_10954819	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	910	Open in IMG/M
3300009162\|Ga0075423_11057255	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	863	Open in IMG/M
3300010046\|Ga0126384_10738732	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	876	Open in IMG/M
3300010047\|Ga0126382_10531659	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	952	Open in IMG/M
3300010336\|Ga0134071_10027544	All Organisms → cellular organisms → Bacteria	2458	Open in IMG/M
3300010366\|Ga0126379_10111024	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2465	Open in IMG/M
3300010366\|Ga0126379_10283468	All Organisms → cellular organisms → Bacteria	1652	Open in IMG/M
3300010366\|Ga0126379_10919579	Not Available	978	Open in IMG/M
3300010366\|Ga0126379_11277024	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300010366\|Ga0126379_12019662	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300010398\|Ga0126383_10238604	Not Available	1775	Open in IMG/M
3300010398\|Ga0126383_11487177	All Organisms → cellular organisms → Bacteria → FCB group	767	Open in IMG/M
3300010398\|Ga0126383_11923098	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Salinimicrobium → Salinimicrobium catena	679	Open in IMG/M
3300010398\|Ga0126383_12612422	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300010399\|Ga0134127_12072996	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300010401\|Ga0134121_12040509	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	607	Open in IMG/M
3300011120\|Ga0150983_12995670	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	502	Open in IMG/M
3300011120\|Ga0150983_13193113	Not Available	604	Open in IMG/M
3300011434\|Ga0137464_1000305	All Organisms → cellular organisms → Bacteria	16133	Open in IMG/M
3300012199\|Ga0137383_10421197	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	978	Open in IMG/M
3300012212\|Ga0150985_102389415	All Organisms → cellular organisms → Bacteria → Acidobacteria	826	Open in IMG/M
3300012212\|Ga0150985_104733690	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	552	Open in IMG/M
3300012212\|Ga0150985_108323772	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	579	Open in IMG/M
3300012212\|Ga0150985_116799195	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	763	Open in IMG/M
3300012685\|Ga0137397_10814569	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300012948\|Ga0126375_11640647	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	555	Open in IMG/M
3300012986\|Ga0164304_10259228	All Organisms → cellular organisms → Bacteria	1170	Open in IMG/M
3300013296\|Ga0157374_12078592	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	595	Open in IMG/M
3300013297\|Ga0157378_10456518	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1269	Open in IMG/M
3300015371\|Ga0132258_10105890	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	6644	Open in IMG/M
3300015371\|Ga0132258_12282210	All Organisms → cellular organisms → Bacteria	1357	Open in IMG/M
3300015371\|Ga0132258_12857229	Not Available	1201	Open in IMG/M
3300016341\|Ga0182035_11306873	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	649	Open in IMG/M
3300016422\|Ga0182039_11770536	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	566	Open in IMG/M
3300017792\|Ga0163161_10984018	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	719	Open in IMG/M
3300018482\|Ga0066669_12302009	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300021168\|Ga0210406_10221169	All Organisms → cellular organisms → Bacteria	1564	Open in IMG/M
3300021168\|Ga0210406_10696163	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300022506\|Ga0242648_1031925	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	734	Open in IMG/M
3300022507\|Ga0222729_1065870	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526	Open in IMG/M
3300022531\|Ga0242660_1217693	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	532	Open in IMG/M
3300022532\|Ga0242655_10132994	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	714	Open in IMG/M
3300022722\|Ga0242657_1095752	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	724	Open in IMG/M
3300025922\|Ga0207646_10004611	All Organisms → cellular organisms → Bacteria	14898	Open in IMG/M
3300025944\|Ga0207661_10361213	All Organisms → cellular organisms → Bacteria	1312	Open in IMG/M
3300026277\|Ga0209350_1075329	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	926	Open in IMG/M
3300027646\|Ga0209466_1025190	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1229	Open in IMG/M
3300027874\|Ga0209465_10217527	Not Available	954	Open in IMG/M
3300027874\|Ga0209465_10344784	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M
3300027909\|Ga0209382_10248427	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2021	Open in IMG/M
3300027909\|Ga0209382_10513567	All Organisms → cellular organisms → Bacteria	1318	Open in IMG/M
3300027909\|Ga0209382_12088963	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	540	Open in IMG/M
3300031424\|Ga0308179_1052840	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	532	Open in IMG/M
3300031910\|Ga0306923_10337083	Not Available	1721	Open in IMG/M
3300031910\|Ga0306923_11883832	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	611	Open in IMG/M
3300031962\|Ga0307479_12181649	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300031965\|Ga0326597_11350855	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	694	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.65%
Host-Associated	Host-Associated	23.48%
Engineered	Engineered	0.87%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.78%
Plants	Host-Associated → Plants	22.61%
Aquatic	Environmental → Aquatic	0.87%
Human	Host-Associated → Human	0.87%
Solid Waste	Engineered → Solid Waste	0.87%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.78%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.83%
Sediment	Environmental → Aquatic → Sediment	0.87%
Digestive System	Host-Associated → Human → Digestive System	0.87%
Grass	Engineered → Solid Waste → Grass	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.43%
Loam	Environmental → Terrestrial → Soil → Loam	24.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.09%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.87%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.87%
Composting	Engineered → Solid Waste → Grass → Composting	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.13%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	18.26%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	17.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.78%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.09%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.22%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.61%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.87%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.87%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.87%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	13.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	12.17%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	11.30%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.43%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	6.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.48%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.48%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	3.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.61%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.61%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.74%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.74%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.74%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.74%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.74%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.87%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.87%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.87%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.87%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.87%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.87%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004103	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011434	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300022506	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022507	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022532	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4MG_01272450	2170459019	Switchgrass, Maize And Mischanthus Litter	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVK
F14TC_1077322612	3300000559	Soil	MSFIEGIVVNVAVLVISXXXXXGLGHLFLSVVIKDRRPS*
soilL2_100211323	3300003319	Sugarcane Root And Bulk Soil	MEWIEDVLVSVGVLLISGGCAVALGHFFLSVVVKDRRSS*
Ga0058903_14768942	3300004103	Forest Soil	MDFIEDIVVNVAVLVISGASAVALGHLFLSVIVKDRRPSA*
Ga0066398_100751472	3300004268	Tropical Forest Soil	MTLLEDIFVSVAVLVISGASALALGHFFLSVVVKDRRSS*
Ga0066395_108277571	3300004633	Tropical Forest Soil	MTLLEDIFVSVAVLVISGASALALGHLFLSVVVKDRRSS*
Ga0058861_112874611	3300004800	Host-Associated	MAILEDIFVNVAVLVISGASAVALGHLFLSVVVKDRRSS*
Ga0066677_100418692	3300005171	Soil	MVVLESIVINLAVLAISGASAVGLGHLFLSVVVKDRRTS*
Ga0066679_108932661	3300005176	Soil	MIAVVESIAINLVVLEISGASALGLGHLFLSVVVKDRRSSS*
Ga0066685_101952772	3300005180	Soil	MSFLEDIFVNVAVLLISGASALALGHLFLKVVLKDRRSP*
Ga0066685_107342632	3300005180	Soil	MAVFESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRTS*
Ga0066671_102764312	3300005184	Soil	MAVFESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRTSQ*
Ga0066675_102313432	3300005187	Soil	MAIFESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRTSQ*
Ga0066388_1008719272	3300005332	Tropical Forest Soil	MSVIEDIVMDLAVLVISGASALALGHLFLSVVVKDRRSS*
Ga0066388_1014667162	3300005332	Tropical Forest Soil	MTLLEEIFVSVAVLVISGASALALGHFFLSVVVKDRRSS*
Ga0066388_1020072602	3300005332	Tropical Forest Soil	MSFIEGIVVNVAVLVISGASAVGLGHLFLSVVIKDRRPS*
Ga0066388_1027597412	3300005332	Tropical Forest Soil	MSVLEEIFVSIAVLVISGASALALGHLFLSVVVKDRRPS*
Ga0066388_1028327061	3300005332	Tropical Forest Soil	MTLIEDIFVSVAVLVISGASALALGHFFLSVVVKDRRSS*
Ga0066388_1038588752	3300005332	Tropical Forest Soil	MAVLESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRSS*
Ga0066388_1045908051	3300005332	Tropical Forest Soil	MDVIEGIVVNVAVLVISGLSALALGHLFLSVVVKDRRPS*
Ga0066388_1082782542	3300005332	Tropical Forest Soil	MSVIEDIVMNLAVLVISGASAVALGHLFLSVVVKDRRSS*
Ga0066686_103941591	3300005446	Soil	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVKNRRSSSSSSS*
Ga0066686_104265711	3300005446	Soil	MIALVESIAINLVVLVISGASAIGLGHLFLSVVVKDRRSS
Ga0066681_108120481	3300005451	Soil	MAVLEDIFVNVAVLVISGASAVALGHLVLSVVVKDRRTSN*
Ga0070681_103876582	3300005458	Corn Rhizosphere	MSVIEDIVVSLAVLVISGASAVALGHFFLSFVVKDRRSS*
Ga0070707_1015869711	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MTILEDIVVRVAVLVISGASAVGLGHLLLSVVIKDRSIR*
Ga0070741_117296592	3300005529	Surface Soil	MSVIEDIVMNLAVLVISGASAVALGHVFLSVIVKDRRSSS*
Ga0070679_1004104562	3300005530	Corn Rhizosphere	MSVIEDIVVSLAVLVISGASALALGHFFLSFVVKDRRSS*
Ga0070679_1007034091	3300005530	Corn Rhizosphere	MSVIEDIVMDLAVLVISGASALALGHLFLSVVVKDRRPS*
Ga0070731_100768623	3300005538	Surface Soil	MAVLESIVVDLAVLAISGLSALGLGHLFLSFMVKDRRSS*
Ga0066698_105211281	3300005558	Soil	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVKDRRSSSSSSS*
Ga0066705_105837682	3300005569	Soil	MSLLEDMFVSVAVLLISGASAIALGHLFLSAVVRDRKH*
Ga0066654_109291612	3300005587	Soil	ESIAINLVVLVISGASALGLGHLFLSVVVKDRRSSS*
Ga0070762_111228572	3300005602	Soil	MDLIEDIVVNVAVLVISGASAVALGHLFLSVLVKDRRPSR*
Ga0066905_1000274913	3300005713	Tropical Forest Soil	MTLLEDIFVSVAVLVISGASALALGHLFLSVVVKDRRS*
Ga0066903_1014538803	3300005764	Tropical Forest Soil	MGFIEEVIVSIAVLVLSGASALALGHFFLSVVVKDRRSS*
Ga0066903_1057614242	3300005764	Tropical Forest Soil	MSILEEIFVSIAVLVISGASALALGHLFLSVVVKDRRPS*
Ga0068862_1018194293	3300005844	Switchgrass Rhizosphere	MTFIEDIFVSFAVLVIYGASALAIGHFFLSVVIRDRRSS*
Ga0066696_101033291	3300006032	Soil	MMNFIEGLLVNVAVLVISGASAVGLGHLFLSVVVKDRRPS*
Ga0075417_101677762	3300006049	Populus Rhizosphere	MNFIEGIVVNVAVLVISGASAVGLGHLFLSVVIKDRRPS*
Ga0079222_110608291	3300006755	Agricultural Soil	MGVLEDLFVSFAVLVISGASAVGLGHLFLSVVVKDRRTS*
Ga0079222_114332543	3300006755	Agricultural Soil	MSFLEDIFVSVAVLVISGASALALGHLFLSVVVKDR
Ga0066659_102281992	3300006797	Soil	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVKDRRSSS*
Ga0066659_103110322	3300006797	Soil	MAVLESIVINLAVLAISGASAVGLGHLFLSVVVKDRRTS*
Ga0075428_1007999242	3300006844	Populus Rhizosphere	MALLEDILVTVGVLVISGASALALGHLFLSVVVKDRRPS*
Ga0075421_1005952172	3300006845	Populus Rhizosphere	IEMTLLEDIFVSVAVLVISGASALALGHLFLSVVVKDRRSS*
Ga0075421_1006783082	3300006845	Populus Rhizosphere	MAIIEDVLVTGVVLLISGASALALGHFFLRVVVKDRRSS*
Ga0075421_1021096361	3300006845	Populus Rhizosphere	GLIEMTLLEDIFVSVAVLVISGASALALGHLFLSVVVKDRRSS*
Ga0075425_1003971763	3300006854	Populus Rhizosphere	MSFIEELFVSVAVLVVSGASAVALGHFVLSVVVKDRRSS*
Ga0075425_1005564472	3300006854	Populus Rhizosphere	MVVLESIVINLAVLAISGASAVGLGHLFLSVVVKDRR*
Ga0066710_1002022265	3300009012	Grasslands Soil	MSFLEDIFVNVAVLLISGASALALGHLFLKVVLKDRRSP
Ga0066710_1002165803	3300009012	Grasslands Soil	MSLIEDMFVSVAVLLISGASAIALGHLFLSAVVRDRKH
Ga0066710_1011997222	3300009012	Grasslands Soil	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVKNRRSSSSS
Ga0066710_1034751862	3300009012	Grasslands Soil	MTTLEDIVVTVAVLVISGASAVGLCHLFLSVVIKDRSIR
Ga0105245_126937392	3300009098	Miscanthus Rhizosphere	MTILGDIVVRVAVLVISGASAVGLGHLLLSVVIKDRSIR*
Ga0066709_1014261031	3300009137	Grasslands Soil	MAVFESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRPSQ*
Ga0105243_114895102	3300009148	Miscanthus Rhizosphere	MDMLEGLFVNVAVLVISGASAVALGHLVLSVVVKDRRS*
Ga0111538_114297242	3300009156	Populus Rhizosphere	MGFLSELFVTVVVLLISGGSALALGHFFLSVVVKDRRPS*
Ga0075423_109548193	3300009162	Populus Rhizosphere	MTLIEDIFVGVAVLVISGASALALGHFFLSVVVKDRRSS*
Ga0075423_110572552	3300009162	Populus Rhizosphere	MSFLSELFVTVVVLVISGGSALALGHFFLSMVVKDRRTS*
Ga0126384_107387321	3300010046	Tropical Forest Soil	MAFIEDFLVTVVVLVISAGSALALGHFFLSVVVKDRRPS*
Ga0126382_105316591	3300010047	Tropical Forest Soil	MDLIEGIVINIAVLVISGVSALALGHWLLSVVVKDRRPS
Ga0134071_100275442	3300010336	Grasslands Soil	MIALVESIAINLVVLVISGASAIGLGHLFLSVVVKDRRSSSSSS*
Ga0126379_101110242	3300010366	Tropical Forest Soil	MNFIEGIVVNVAVLVISGASAVGLGHLFLSVVLKDRRPS*
Ga0126379_102834682	3300010366	Tropical Forest Soil	MSVIEDIVVNLAVLVISGASAVALGHLFLSVVVKDRRS*
Ga0126379_109195791	3300010366	Tropical Forest Soil	QGQREMSVIEDIVMNLAVLVISGASAVALGHLFLSVVVKDRRSS*
Ga0126379_112770242	3300010366	Tropical Forest Soil	MSVIEDIVMDLAVLVISGASALALGHLFLSVFVKDRRPS*
Ga0126379_120196621	3300010366	Tropical Forest Soil	MSVIEDIVVDLAVLVISGASALALGHLFLSVVVKDRRPS*
Ga0126383_102386041	3300010398	Tropical Forest Soil	LLEDIFVSVAVLVISGASALALGHFFLSVVVKDRRSS*
Ga0126383_114871772	3300010398	Tropical Forest Soil	MSVIEDIVMNLAVLVISGASAVALGHLFLSVVVKDRRS*
Ga0126383_119230982	3300010398	Tropical Forest Soil	LMSVIEDIVMDLAVLVISGASALALGHLFLSVVVKDRRPS*
Ga0126383_126124221	3300010398	Tropical Forest Soil	MSVIEDIVMDLAVLVISGVSALALGHLFLSVVVKDRRSS*
Ga0134127_120729962	3300010399	Terrestrial Soil	MSFLSELFVTVAVLVISGGSALALGHFFLSMVVKDRRTS*
Ga0134121_120405092	3300010401	Terrestrial Soil	TILGDIVVRVAVLVISGASAVGLGHLLLSVVIKDRSIR*
Ga0150983_129956702	3300011120	Forest Soil	MDVIEDIVVNVAVLVISGASAVALGHLFLSVLVKDRRPPA*
Ga0150983_131931132	3300011120	Forest Soil	MDLIEDIVVNVAVLVISGASAVALGHLFLSVLVKDRRPSA*
Ga0137464_100030514	3300011434	Soil	MNEIATILVAVAVLVISGVSALALGHLVLSFVVKDRRP*
Ga0137383_104211972	3300012199	Vadose Zone Soil	MSLIEDMFVSVAVLLISGASAIALGHLFLSAVVRDRKH*
Ga0150985_1023894152	3300012212	Avena Fatua Rhizosphere	MSVIEDIVMNLAVLVISGASALALGHLFLSVVVKDRRSSS*
Ga0150985_1047336902	3300012212	Avena Fatua Rhizosphere	MNVIEDIVVNLAVLVISGASAVALGHLFLSVVVKDRRSS*
Ga0150985_1083237722	3300012212	Avena Fatua Rhizosphere	MEVIEDVVVGVAVFVLSGASALALSHFFLSMVVKDRRPS*
Ga0150985_1167991952	3300012212	Avena Fatua Rhizosphere	MSVIEDIFVSVAVLVISGASAVAIGHLFLSVVVRNRRPS*
Ga0137397_108145692	3300012685	Vadose Zone Soil	MLTVFESIVMNLAVLVISGASALGLGHLFLSVVVKDRRSS
Ga0126375_116406472	3300012948	Tropical Forest Soil	MNVFESIVMDLAVLVISGGSALALGHLFLSVVVKDRRP*
Ga0164304_102592281	3300012986	Soil	RRGITTTMSFIEELFVSVAVLVVSGASAVALGHFVLSVVVKDRRSS*
Ga0157374_120785921	3300013296	Miscanthus Rhizosphere	MTMIEDLLVTVAVLIISGASAVGLGHVFLSFVIRDRRPS*
Ga0157378_104565182	3300013297	Miscanthus Rhizosphere	MTFIEDIFVSFAVLVISGASALAIGHFFLSVVIRDRRSS*
Ga0132258_101058904	3300015371	Arabidopsis Rhizosphere	MNLLETILVSVAVLFVSGATAVGLGHFFLSVLIKDRRTS*
Ga0132258_122822103	3300015371	Arabidopsis Rhizosphere	MNFIEGIVVNVAVLVISGASAVGLGHLFLSVVIKDRRPS
Ga0132258_128572291	3300015371	Arabidopsis Rhizosphere	TMSFLEDIFVSVAVLLISSGSALAIGHLFLSVVVKDRRS*
Ga0182035_113068731	3300016341	Soil	MSVIEDLFVSVAVLVISGASAVALGHIVLSVVVKDRRS
Ga0182039_117705361	3300016422	Soil	KMMAVFENIVMNLAVLAISGASALGLGHLFLSVVVKDRRS
Ga0163161_109840182	3300017792	Switchgrass Rhizosphere	MTFIEDIFVSFAVLVISGASALAIGHFFLSVVIRDRRSS
Ga0066669_123020091	3300018482	Grasslands Soil	MAVFESLVVDLAVLAISGLSALGLGHLFLSVVVKDRRTSQ
Ga0210406_102211692	3300021168	Soil	MSVIEDIVMNLAVLVISGASAVALGHLFLSVVVKDRRSS
Ga0210406_106961632	3300021168	Soil	MSVIEDIVMDLAVLVISGASALALGHLFLSVVVKDRRPS
Ga0242648_10319252	3300022506	Soil	MDVIEDIVVNLAVLVISGASAVALGHLFLSVLVKDRRPPA
Ga0222729_10658702	3300022507	Soil	MEVIEDIVVNVAVLVISGASALALGRLFLSVVVKDRRPPG
Ga0242660_12176931	3300022531	Soil	MDLIEDIVVNLAVLVISGASAVALGHLFLSVLVKDRRPSS
Ga0242655_101329942	3300022532	Soil	MDIIEDIVVNVAVLVISGASAVALGHLFLSVIVKDRRPSA
Ga0242657_10957522	3300022722	Soil	MDFIEDIVVNVAVLVISGASAVALGHLFLSVLVKDRRPSA
Ga0207646_1000461111	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MVVLESIVINLAVLAISGASAVGLGHLFLSVVVKDRRTS
Ga0207661_103612132	3300025944	Corn Rhizosphere	MSVIEDIVVSLAVLVISGASAVALGHFFLSFVVKDRRSS
Ga0209350_10753292	3300026277	Grasslands Soil	MIAVVESIAINLVVLVISGASALGLGHLFLSVVVKDRRSSS
Ga0209466_10251903	3300027646	Tropical Forest Soil	MTLLEDIFVSVAVLVISGASALALGHLFLSVVVKDRRSS
Ga0209465_102175271	3300027874	Tropical Forest Soil	MSFIEGIVVNVAVLVISGASAVGLGHLLLSVVLKDRRPS
Ga0209465_103447842	3300027874	Tropical Forest Soil	MSVIEDIVMNLAVLVISGASALALGHLFLSVVVKDRRSS
Ga0209382_102484272	3300027909	Populus Rhizosphere	MAIIEDVLVTGVVLLISGASALALGHFFLRVVVKDRRSS
Ga0209382_105135671	3300027909	Populus Rhizosphere	LLEDILVTVGVLVISGASALALGHLFLSVVVKDRRPS
Ga0209382_120889632	3300027909	Populus Rhizosphere	MGILGDMFVGVAVLVISGASALALGHLFLSFVIKDRRSS
Ga0308179_10528401	3300031424	Soil	MTTLEDIVVSVAVLVISGVSAVGLGHLFLRVVIKDRSIR
Ga0306923_103370832	3300031910	Soil	FENIVMNLAVLAISGASALGLGHLFLSVVVKDRRP
Ga0306923_118838322	3300031910	Soil	MSVIEDLFVSVAVLVISGASAVALGHIVLSVVVKDRRSS
Ga0307479_121816492	3300031962	Hardwood Forest Soil	MLAVFESIVMNLAVLVISGASALGLGHLFLSVVVKDRRS
Ga0326597_113508552	3300031965	Soil	MEILESIFVSGAVLVISGASAVALGHLFLRMIVKSRRPSQTPVIKN

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F079914

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences