NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079855

Metagenome / Metatranscriptome Family F079855

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079855
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 50 residues
Representative Sequence VSMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF
Number of Associated Samples 105
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.61 %
% of genes near scaffold ends (potentially truncated) 94.78 %
% of genes from short scaffolds (< 2000 bps) 93.04 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.391 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(19.130 % of family members)
Environment Ontology (ENVO) Unclassified
(29.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.58%    β-sheet: 23.38%    Coil/Unstructured: 61.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF07364DUF1485 8.70
PF07690MFS_1 6.09
PF13450NAD_binding_8 5.22
PF00892EamA 3.48
PF13193AMP-binding_C 3.48
PF04191PEMT 1.74
PF10576EndIII_4Fe-2S 1.74
PF00730HhH-GPD 0.87
PF12680SnoaL_2 0.87
PF05977MFS_3 0.87
PF00903Glyoxalase 0.87
PF08486SpoIID 0.87
PF00515TPR_1 0.87
PF00285Citrate_synt 0.87
PF12681Glyoxalase_2 0.87
PF01839FG-GAP 0.87
PF05544Pro_racemase 0.87
PF13374TPR_10 0.87
PF13231PMT_2 0.87
PF02653BPD_transp_2 0.87
PF13411MerR_1 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG5476Microcystin degradation protein MlrC, contains DUF1485 domainGeneral function prediction only [R] 8.70
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.87
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.87
COG0372Citrate synthaseEnergy production and conversion [C] 0.87
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.87
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.87
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.87
COG2385Peptidoglycan hydrolase (amidase) enhancer domain SpoIIDCell wall/membrane/envelope biogenesis [M] 0.87
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.87
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000886|AL3A1W_1081924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1548Open in IMG/M
3300001536|A1565W1_10664783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium669Open in IMG/M
3300004156|Ga0062589_100067430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2107Open in IMG/M
3300005172|Ga0066683_10320941All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300005177|Ga0066690_10406439All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300005177|Ga0066690_10524194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi795Open in IMG/M
3300005177|Ga0066690_10688360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium678Open in IMG/M
3300005178|Ga0066688_10423058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300005294|Ga0065705_11090253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi525Open in IMG/M
3300005334|Ga0068869_101650099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi571Open in IMG/M
3300005343|Ga0070687_101151967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi570Open in IMG/M
3300005366|Ga0070659_101346631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi634Open in IMG/M
3300005441|Ga0070700_101549025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi565Open in IMG/M
3300005447|Ga0066689_10697303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi635Open in IMG/M
3300005458|Ga0070681_10188106All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300005468|Ga0070707_100032277All Organisms → cellular organisms → Bacteria4988Open in IMG/M
3300005468|Ga0070707_101641837Not Available610Open in IMG/M
3300005518|Ga0070699_100539186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1062Open in IMG/M
3300005518|Ga0070699_102019566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300005536|Ga0070697_101915446All Organisms → cellular organisms → Bacteria → Terrabacteria group530Open in IMG/M
3300005537|Ga0070730_10015311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6117Open in IMG/M
3300005539|Ga0068853_102221115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300005549|Ga0070704_100728384All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005557|Ga0066704_10983903All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300005559|Ga0066700_10306982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1119Open in IMG/M
3300005569|Ga0066705_10631396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi653Open in IMG/M
3300005576|Ga0066708_10053375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2270Open in IMG/M
3300005586|Ga0066691_10027844All Organisms → cellular organisms → Bacteria2891Open in IMG/M
3300005598|Ga0066706_11315180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi546Open in IMG/M
3300005614|Ga0068856_100122597All Organisms → cellular organisms → Bacteria2602Open in IMG/M
3300005718|Ga0068866_10959061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi605Open in IMG/M
3300005844|Ga0068862_101748490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi631Open in IMG/M
3300006796|Ga0066665_10806841All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006797|Ga0066659_11119301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium658Open in IMG/M
3300006797|Ga0066659_11608582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium546Open in IMG/M
3300006852|Ga0075433_10282619All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300006918|Ga0079216_11435368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi573Open in IMG/M
3300007076|Ga0075435_101574862Not Available576Open in IMG/M
3300009012|Ga0066710_102561883All Organisms → cellular organisms → Bacteria → Terrabacteria group735Open in IMG/M
3300009088|Ga0099830_10805074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium775Open in IMG/M
3300009089|Ga0099828_10497292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1099Open in IMG/M
3300009089|Ga0099828_11616411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi570Open in IMG/M
3300009090|Ga0099827_10530006All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300009100|Ga0075418_12911322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi522Open in IMG/M
3300009137|Ga0066709_103933000All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300009148|Ga0105243_12546823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi551Open in IMG/M
3300009162|Ga0075423_10153347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2418Open in IMG/M
3300010087|Ga0127492_1100212All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300010133|Ga0127459_1093260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300010303|Ga0134082_10085082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1241Open in IMG/M
3300010325|Ga0134064_10091170All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300010362|Ga0126377_12815171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi561Open in IMG/M
3300010373|Ga0134128_11764255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium681Open in IMG/M
3300010375|Ga0105239_13398407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi518Open in IMG/M
3300011270|Ga0137391_10240939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1569Open in IMG/M
3300012001|Ga0120167_1116455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium538Open in IMG/M
3300012019|Ga0120139_1165855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium579Open in IMG/M
3300012203|Ga0137399_11656373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi528Open in IMG/M
3300012206|Ga0137380_10766596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium834Open in IMG/M
3300012285|Ga0137370_10551786All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012360|Ga0137375_11336246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi538Open in IMG/M
3300012362|Ga0137361_10037044All Organisms → cellular organisms → Bacteria3927Open in IMG/M
3300012400|Ga0134048_1184887All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300012402|Ga0134059_1303170All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300012681|Ga0136613_10803587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi501Open in IMG/M
3300012923|Ga0137359_10600729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium965Open in IMG/M
3300012977|Ga0134087_10509221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300013831|Ga0120126_1040587All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300015190|Ga0167651_1096697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi558Open in IMG/M
3300015372|Ga0132256_103203491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium550Open in IMG/M
3300017997|Ga0184610_1246762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300018000|Ga0184604_10011474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1889Open in IMG/M
3300018027|Ga0184605_10257675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi792Open in IMG/M
3300018052|Ga0184638_1158475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi814Open in IMG/M
3300018071|Ga0184618_10487012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi517Open in IMG/M
3300018074|Ga0184640_10471038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi556Open in IMG/M
3300018431|Ga0066655_10530557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi784Open in IMG/M
3300019259|Ga0184646_1046080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300020202|Ga0196964_10700269Not Available502Open in IMG/M
3300025910|Ga0207684_10602100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi939Open in IMG/M
3300025912|Ga0207707_10842581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi761Open in IMG/M
3300025918|Ga0207662_10547476All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025921|Ga0207652_11675397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi540Open in IMG/M
3300025922|Ga0207646_10215904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1732Open in IMG/M
3300025922|Ga0207646_10658036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi938Open in IMG/M
3300025922|Ga0207646_11372707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300025922|Ga0207646_11689183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300025934|Ga0207686_10290786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1210Open in IMG/M
3300025942|Ga0207689_10750100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium824Open in IMG/M
3300025949|Ga0207667_11940594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium550Open in IMG/M
3300026041|Ga0207639_11546947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300026298|Ga0209236_1057432All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300026300|Ga0209027_1231105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium593Open in IMG/M
3300026309|Ga0209055_1156586All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300026317|Ga0209154_1290207All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300026318|Ga0209471_1245178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium622Open in IMG/M
3300026523|Ga0209808_1185418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium726Open in IMG/M
3300026536|Ga0209058_1153043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1078Open in IMG/M
3300026537|Ga0209157_1277862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi627Open in IMG/M
3300026552|Ga0209577_10388642All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300027637|Ga0209818_1223993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi558Open in IMG/M
3300027873|Ga0209814_10432370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi580Open in IMG/M
3300027882|Ga0209590_10810713All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300028006|Ga0247717_1016115All Organisms → cellular organisms → Bacteria → Terrabacteria group1181Open in IMG/M
3300028711|Ga0307293_10047482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1330Open in IMG/M
3300028771|Ga0307320_10225542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi736Open in IMG/M
3300028792|Ga0307504_10390277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium545Open in IMG/M
3300028828|Ga0307312_10790995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium628Open in IMG/M
3300028885|Ga0307304_10045204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1611Open in IMG/M
3300030905|Ga0308200_1146952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300031093|Ga0308197_10426761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300031720|Ga0307469_11112541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi743Open in IMG/M
3300031965|Ga0326597_11093788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium796Open in IMG/M
3300031965|Ga0326597_11196131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi751Open in IMG/M
3300034164|Ga0364940_0144112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi685Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil19.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.09%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.22%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.35%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.35%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.48%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.87%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010133Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013831Permafrost microbial communities from Nunavut, Canada - A21_5cm_6MEnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028006Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-4-E_NEnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AL3A1W_108192423300000886PermafrostTDIGSFVSMEFNMSPGGRPISVRVRGTGAWVDLKGDRFLRTTLGLKSTLVRTILF*
A1565W1_1066478313300001536PermafrostTDIGSFVSMEFNMSPGGRPISVRVRGTGASVDLKGDRFLRTTLGLRSTLVRTIPF*
Ga0062589_10006743013300004156SoilGIDIGRFVSMAFNESPGGRPISVIVRGSIRSIDLHGERFLRATLGLPSTLVRTTPF*
Ga0066683_1032094113300005172SoilGDFVSMEFKVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0066690_1040643923300005177SoilGRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF*
Ga0066690_1052419413300005177SoilSLGFNLSPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPSTLIRTTPF*
Ga0066690_1068836023300005177SoilFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF*
Ga0066688_1042305833300005178SoilEDYGIDIGDFVSLELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF*
Ga0065705_1109025323300005294Switchgrass RhizospherePGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0068869_10165009913300005334Miscanthus RhizosphereIGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0070687_10115196713300005343Switchgrass RhizosphereVDIGHLVSIRFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0070659_10134663113300005366Corn RhizosphereNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0070700_10154902513300005441Corn, Switchgrass And Miscanthus RhizosphereVSMEFNESPGGRPISVRVRGTGASVDLKGDRFLRTVLGLRSTLVRTRPF*
Ga0066689_1069730323300005447SoilMQFNESPGGRPISVRVYGTDASIDLKGDRVLRTTLGLKSTLVRTVPF*
Ga0070681_1018810623300005458Corn RhizosphereVDIGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF*
Ga0070707_10003227763300005468Corn, Switchgrass And Miscanthus RhizosphereIIEDYGVDIGSFVAMEFNMSPGGRPVSVQVRGTDRWVDLKGDRFLRNTLGLKSTLVKTVRF*
Ga0070707_10164183723300005468Corn, Switchgrass And Miscanthus RhizosphereIIEDYGVDIGNFVSLEFNQSPGGRPISVQVRGTDRWVDLKGDRFLRTTLGLKSTLVKTVRF*
Ga0070699_10053918643300005518Corn, Switchgrass And Miscanthus RhizosphereDIGQFVSLAFNESPGGRPISVIVRGSRRSVDLNGDQFLRNTLGLPSTLVKTTPF*
Ga0070699_10201956623300005518Corn, Switchgrass And Miscanthus RhizosphereLSPSGRPISVRVQGTRTTVDLKGDKFLRETLGLPANLVRTSPF*
Ga0070697_10191544613300005536Corn, Switchgrass And Miscanthus RhizosphereYGLDIGTFVSMEFNMSPGGRPISVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF*
Ga0070730_1001531113300005537Surface SoilDYGVDIGDYVWMQFNESPGGRPISVRVYGTDASVDLKGDRFLRTTLGLRSTLVRTIPF*
Ga0068853_10222111513300005539Corn RhizosphereFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF*
Ga0070704_10072838433300005549Corn, Switchgrass And Miscanthus RhizosphereNMSPGQRPISVRVRGTAGAVDLKGDRFLRTTLGLKSTLVRTTPF*
Ga0066704_1098390323300005557SoilGGRPISVLVRGAHDWVDLKGDRFLRTTLGLKSTLVRMIPF*
Ga0066700_1030698223300005559SoilSVRVRGTNAAADLKGDRFLRTTLGLKSTLVSTTPF*
Ga0066705_1063139613300005569SoilMSPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPSTLVRTTGF*
Ga0066708_1005337533300005576SoilQIIEDYGIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF*
Ga0066691_1002784433300005586SoilFVSMEFNLSPGGRPISVLVRGTGDWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0066706_1131518013300005598SoilPGGRPISVRVQGTSAAVDLKGDRFLRTTLGLKSTLVSTMPF*
Ga0068856_10012259713300005614Corn RhizosphereMSRGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF*
Ga0068866_1095906123300005718Miscanthus RhizospherePISVLVRGTSSDIDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0068862_10174849023300005844Switchgrass RhizosphereIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0066665_1080684113300006796SoilGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0066659_1111930123300006797SoilGIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF*
Ga0066659_1160858223300006797SoilGVDIGPFVSIAFNESPGGRPISVMIRGSCRSVDLNGDQFLRATLGLPSTLVQTTPF*
Ga0075433_1028261913300006852Populus RhizosphereWDEYGVDIGGFVSLAFNESPAGRPISVRVRGTLAAVDLRGDRFLRTVLGLKSTLVSTRPF
Ga0079216_1143536813300006918Agricultural SoilDIGRFVSMDFNMSPGERPISVRVRGTDAALDLKGDRFLRTTLGLKSTLVRTTPF*
Ga0075435_10157486223300007076Populus RhizosphereGNFVAMAFNTSPGGRPVSVQVRGTDRWVDLKGDRFLRSTLGLKSTLVKTVRF*
Ga0066710_10256188313300009012Grasslands SoilYGVDVGQFVSLAFNESPGGRPISVIVRGSRRSIDLNGDQFLRRTLGLASTMVRTTPF
Ga0099830_1080507413300009088Vadose Zone SoilDIGSFISIEFNESPGGRPISVRVRGTSAAVDLKADRFLRTTLGLKSTLVHTTPF*
Ga0099828_1049729233300009089Vadose Zone SoilVSLAFNDSPAGRPISVVVRGSNQSVDLNGEQFLRATLGLRSTLVETTPF*
Ga0099828_1161641113300009089Vadose Zone SoilGSFISIEFNESPGGRPISVRVRGTSAVVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0099827_1053000633300009090Vadose Zone SoilSVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0075418_1291132223300009100Populus RhizosphereMDFNMSPGERPISVRVRGTEASLDLKGDRFLRTTLGLKSTLVRTTPF*
Ga0066709_10393300023300009137Grasslands SoilGGRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF*
Ga0105243_1254682313300009148Miscanthus RhizosphereLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF*
Ga0075423_1015334743300009162Populus RhizosphereRREIWNDYGYDIGGFVAMRFNESPGGRPISVQIDGTRMTVDLKGDRFLRTTLGLRSTLVRTTPF*
Ga0127492_110021223300010087Grasslands SoilFNVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0127459_109326023300010133Grasslands SoilDYGVDIGRFVSIAFNESPGGRPISVVIRGSSRSVDLNGDQFLRATLGLRSTLVRTTPF*
Ga0134082_1008508223300010303Grasslands SoilVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF*
Ga0134064_1009117023300010325Grasslands SoilPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF*
Ga0126377_1281517123300010362Tropical Forest SoilSVGFNESPGGRPISVRVQGTLDTVDLKGDRFLRSTLGLPATLVRTSPF*
Ga0134128_1176425523300010373Terrestrial SoilSMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF*
Ga0105239_1339840723300010375Corn RhizosphereFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF*
Ga0137391_1024093913300011270Vadose Zone SoilIGQFVSMAFNESAGGRPISVIVRGSRRSVDLNGDQFLRRTLGLASTMVRTAPF*
Ga0120167_111645523300012001PermafrostDHGLRGDIGFFVSMGFNESPGGRPISVVIRGSTRSVDLNGEQFLRNTLGLRSTLVQTTPF
Ga0120139_116585513300012019PermafrostISVRVRGTGAWVDLKGDRFLRTTLGLKSTLVRTILF*
Ga0137399_1165637313300012203Vadose Zone SoilGSFISLEFNESPGGRPISVRVQGTSAAVNLKGDRFLRTTLGLKSTLVNTTPF*
Ga0137380_1076659623300012206Vadose Zone SoilDIGRFVSMAFNESPGGRPISVVIRGSSRSVDLNGDQFLRATLGLRSTLVRTTPF*
Ga0137370_1055178613300012285Vadose Zone SoilLEFNESPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0137375_1133624613300012360Vadose Zone SoilISMEFNMSPGGRPISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTTPF*
Ga0137361_1003704413300012362Vadose Zone SoilSPGGRPISVRVQGTSAAVDLKGDRFLRTTLGLKSTLVSTTPF*
Ga0134048_118488723300012400Grasslands SoilVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0134059_130317023300012402Grasslands SoilDFVSMEFNMSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF*
Ga0136613_1080358713300012681Polar Desert SandEIITDYGIDIGQFIAMKFAYSPGGRPLSVKVVGSLGVADLAGDRFLRTTLGMKSSLVRTTPF*
Ga0137359_1060072923300012923Vadose Zone SoilVSMEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF*
Ga0134087_1050922123300012977Grasslands SoilDYGVDIGQFLSIAFNESAGGRPISVIVRGNRRSVDLHGDQFLRRTLGLASTMVRTAPF*
Ga0120126_104058723300013831PermafrostMAFNENPGGRPISVVVRGSARSIDLNGEQFLRGTLGLRSTLVRTTPF*
Ga0167651_109669713300015190Glacier Forefield SoilFNESPGGRPISVRVRGTAASVDVKGDRFLRTVLGLRSTLVRTRPF*
Ga0132256_10320349113300015372Arabidopsis RhizosphereGIDIGAYVAMQFNMSPGGRPISVRIRGSYATVDLKGDRFLRTTLGLKSTLVRAIPF*
Ga0184610_124676223300017997Groundwater SedimentFVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF
Ga0184604_1001147433300018000Groundwater SedimentDIGHLVSLQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0184605_1025767513300018027Groundwater SedimentMEFNESPGGRPISVRVRGTGAAVDLKGDRFLRTTLGMKSTLVSTTPF
Ga0184638_115847523300018052Groundwater SedimentEDYGVDIGRFVSIQFNESPGGRPISVLVRGTAADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0184618_1048701223300018071Groundwater SedimentIEDYGVDIGRFVSIQFHESPGGRPVSVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0184640_1047103813300018074Groundwater SedimentEIIVDYGVDIGHFVSMDFNMSPGERPISVRVRGTDAALDLKGDRFLRTTLGLKSTLVRTIPF
Ga0066655_1053055723300018431Grasslands SoilMQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF
Ga0184646_104608013300019259Groundwater SedimentGIDIGQFVSMGFNESPGGRPISVVVRGSNRSVDLHGEQFLRATLGLRSTLVSTTPF
Ga0196964_1070026923300020202SoilGRPVSVRIRASRAAADLPGDRFLRTTLGMRSTLVRTEPF
Ga0207684_1060210023300025910Corn, Switchgrass And Miscanthus RhizosphereSMEFKMSPGGRPLSVVVRGTYDAVDLKGDRFLRTTFGLKSSLVRMIPF
Ga0207707_1084258123300025912Corn RhizosphereVDIGHLVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGMKSTLVHTTPF
Ga0207662_1054747623300025918Switchgrass RhizosphereMSPGGRPISVRVRGTDASVDLKGDRFLRTTLGLKSTLVRTIPF
Ga0207652_1167539713300025921Corn RhizosphereQIIEDYGVDIGHLVSIQFNESPGGRPISVLVRGTYADVDLKGDRFLRTTLGMKSTLVHTTPF
Ga0207646_1021590423300025922Corn, Switchgrass And Miscanthus RhizosphereIGRFVSMGFNESPGGRPISVVVRGSDRSVDLHGGQFLRATLGLRSTLVSTTPF
Ga0207646_1065803633300025922Corn, Switchgrass And Miscanthus RhizosphereEDYGVDIGTFVSMEFKLSPGGRPVSVLIRGTYNFVDLKGDRFLRTTLGLKSTLVRMSPF
Ga0207646_1137270723300025922Corn, Switchgrass And Miscanthus RhizospherePISVRVRGTDAVVDLKGDRFLRTTLGLKSTLVSTTPF
Ga0207646_1168918323300025922Corn, Switchgrass And Miscanthus RhizosphereRMSPGGRPLSVVVRGTYDAVDLKGDRFLRTTFGLKSSLVRMIPF
Ga0207686_1029078623300025934Miscanthus RhizospherePGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0207689_1075010013300025942Miscanthus RhizosphereVSMAFNESPGGRPISVIVRGSIRSIDLHGERFLRATLGLPSTLVRTTPF
Ga0207667_1194059423300025949Corn RhizosphereEFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF
Ga0207639_1154694713300026041Corn RhizosphereFNMSPGGRPISVRVRGTDAWVDLKGDRFLRTTLGLKSTLVRTIPF
Ga0209236_105743213300026298Grasslands SoilMEFNVSPGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIAF
Ga0209027_123110523300026300Grasslands SoilYDIGNYVSMEFNMSPGGRPISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTIPF
Ga0209055_115658633300026309SoilIGDFVSLELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF
Ga0209154_129020723300026317SoilELNMSPGGRPVSVLVRGTHDWVDLKGDRFLRTTLGLKSTLVRMIPF
Ga0209471_124517813300026318SoilIIEDYGIDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIP
Ga0209808_118541813300026523SoilDIGTFVSMEFKESPGGRPISVLVRGTSDSVDLKGDRFLRTTLGLSSTLVRMIPF
Ga0209058_115304313300026536SoilVAMQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF
Ga0209157_127786213300026537SoilFVAMQFNLSPGGRPVSVVVRGTADAVDLKGDRFLRTTLGLKSTLVRAIPF
Ga0209577_1038864213300026552SoilYGVDIGRFVSMEFNMSPGGRPISVRVRGSADWVDLKGDRFLRTTLGLKSTLVKVIPF
Ga0209818_122399323300027637Agricultural SoilIDFNMSPGERPISVRVRGTDASLDLKGDRFLRTTLGLKSTLVRTTPF
Ga0209814_1043237023300027873Populus RhizosphereDIGRFVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0209590_1081071313300027882Vadose Zone SoilGGRPISVLVRGTADWVDLKGDRFLRTTLGLRSTLVRMIPF
Ga0247717_101611523300028006SoilISVRVRGTDGWVDLKGDRFLRTTLGLKSTLVRTNPF
Ga0307293_1004748213300028711SoilMGFNESPGGRPISVVVRGSDRSVDLPGSQFLRDTLGLRSTLVSTTPF
Ga0307320_1022554223300028771SoilLVSLQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0307504_1039027723300028792SoilMQFNESPGGRPISVRVYGSLGSVDLKGDRFLRITLGLKSTLVRTLPF
Ga0307312_1079099523300028828SoilEDYGIDIGQFVSMGFNESPGGRPISVVVRGSDRSVDLHGDQFLRATLGLRSTLVSTTPF
Ga0307304_1004520413300028885SoilVDIGRFVSIQFNESPGGRPISVLVRGTSADVDLKGDRFLRTTLGLKSTLVHTTPF
Ga0308200_114695223300030905SoilQFVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF
Ga0308197_1042676113300031093SoilGQFVSMGFNESPGGRPISVVVRGSNRSVDLPGSQFLRDTLGLRSTLVSTTPF
Ga0307469_1111254123300031720Hardwood Forest SoilYGMDIGGFVAMQFNESPGGRPISVRVRGTLATVDLKGDRFLRTTLGLRSTLVRTWPF
Ga0326597_1109378813300031965SoilDIGRFVSMAFNKSPGGRPISVVVRGSSRSVDLNGDQFLRFTLGLPSTLVRTTPFSRV
Ga0326597_1119613123300031965SoilYGVDIGPFVSMEFSLSPGGRPVSVRVRGSDAAVDLKGDRFLRTTLGLKSTLVRTTPF
Ga0364940_0144112_1_1233300034164SedimentGERPISVRIRGTDAALDLKGDRFLRTTLGLKSTLVRTTPF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.