


| Basic Information | |
|---|---|
| Family ID | F079845 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | GMGLTRDSLVSVMYAEELNSAKSSVTLQRTDRHGILGQKPTDFQVSL |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 25.22 % |
| % of genes near scaffold ends (potentially truncated) | 86.09 % |
| % of genes from short scaffolds (< 2000 bps) | 82.61 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.043 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.783 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.957 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.33% β-sheet: 0.00% Coil/Unstructured: 70.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF09339 | HTH_IclR | 52.17 |
| PF02371 | Transposase_20 | 2.61 |
| PF01548 | DEDD_Tnp_IS110 | 2.61 |
| PF01609 | DDE_Tnp_1 | 1.74 |
| PF13546 | DDE_5 | 1.74 |
| PF00072 | Response_reg | 0.87 |
| PF04255 | DUF433 | 0.87 |
| PF00582 | Usp | 0.87 |
| PF03050 | DDE_Tnp_IS66 | 0.87 |
| PF13586 | DDE_Tnp_1_2 | 0.87 |
| PF00535 | Glycos_transf_2 | 0.87 |
| PF13302 | Acetyltransf_3 | 0.87 |
| PF14490 | HHH_4 | 0.87 |
| PF13551 | HTH_29 | 0.87 |
| PF13641 | Glyco_tranf_2_3 | 0.87 |
| PF01764 | Lipase_3 | 0.87 |
| PF13632 | Glyco_trans_2_3 | 0.87 |
| PF13340 | DUF4096 | 0.87 |
| PF00263 | Secretin | 0.87 |
| PF03811 | Zn_Tnp_IS1 | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 5.22 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.74 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.74 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.74 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.74 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.87 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.87 |
| COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.04 % |
| Unclassified | root | N/A | 6.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120849596 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300005178|Ga0066688_10708465 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005445|Ga0070708_100403407 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005467|Ga0070706_101760712 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005555|Ga0066692_10292031 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005598|Ga0066706_10102472 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2079 | Open in IMG/M |
| 3300005719|Ga0068861_100082271 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300005842|Ga0068858_101514737 | Not Available | 661 | Open in IMG/M |
| 3300005884|Ga0075291_1001492 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300005937|Ga0081455_10149997 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300006797|Ga0066659_10233093 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300006844|Ga0075428_100160830 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300006846|Ga0075430_101541441 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006847|Ga0075431_100088758 | All Organisms → cellular organisms → Bacteria | 3191 | Open in IMG/M |
| 3300006847|Ga0075431_100145388 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300006847|Ga0075431_100279932 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300006852|Ga0075433_11847645 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006854|Ga0075425_101881574 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006969|Ga0075419_10668961 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium IMCC26134 | 734 | Open in IMG/M |
| 3300007255|Ga0099791_10075383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1533 | Open in IMG/M |
| 3300009090|Ga0099827_10194775 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300009090|Ga0099827_11059228 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009147|Ga0114129_11270966 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300009162|Ga0075423_10222737 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300009820|Ga0105085_1102084 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010038|Ga0126315_10151742 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300010359|Ga0126376_10152453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1853 | Open in IMG/M |
| 3300010366|Ga0126379_11006714 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012204|Ga0137374_10255136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1467 | Open in IMG/M |
| 3300012204|Ga0137374_10467006 | Not Available | 987 | Open in IMG/M |
| 3300012351|Ga0137386_11165101 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012362|Ga0137361_10572895 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300012362|Ga0137361_11195144 | Not Available | 683 | Open in IMG/M |
| 3300012930|Ga0137407_10140395 | Not Available | 2123 | Open in IMG/M |
| 3300015373|Ga0132257_104331428 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300015374|Ga0132255_101720341 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300016387|Ga0182040_10311732 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300016404|Ga0182037_10232887 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300018063|Ga0184637_10119031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1628 | Open in IMG/M |
| 3300018063|Ga0184637_10546651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
| 3300018063|Ga0184637_10794490 | Not Available | 505 | Open in IMG/M |
| 3300018077|Ga0184633_10058927 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
| 3300018084|Ga0184629_10053395 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300018084|Ga0184629_10467967 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300018422|Ga0190265_10249512 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300018466|Ga0190268_11325666 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300019233|Ga0184645_1155496 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300019885|Ga0193747_1017238 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300020003|Ga0193739_1020569 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300020005|Ga0193697_1040390 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300021086|Ga0179596_10040895 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300021086|Ga0179596_10144080 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300021086|Ga0179596_10466389 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025157|Ga0209399_10036960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2026 | Open in IMG/M |
| 3300025910|Ga0207684_10086389 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300025918|Ga0207662_10055224 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2370 | Open in IMG/M |
| 3300025922|Ga0207646_10217420 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300025961|Ga0207712_10157745 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300026014|Ga0208776_1005591 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300026025|Ga0208778_1002436 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300026025|Ga0208778_1009099 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300026118|Ga0207675_100082269 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
| 3300026118|Ga0207675_101317714 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026297|Ga0209237_1208520 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300026300|Ga0209027_1066374 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300026312|Ga0209153_1030648 | Not Available | 1834 | Open in IMG/M |
| 3300026313|Ga0209761_1087762 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300026320|Ga0209131_1082823 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300026328|Ga0209802_1162930 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300026331|Ga0209267_1235448 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027362|Ga0208320_1020167 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300027379|Ga0209842_1017573 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300027490|Ga0209899_1046229 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300027577|Ga0209874_1022314 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300027577|Ga0209874_1105402 | Not Available | 668 | Open in IMG/M |
| 3300027643|Ga0209076_1019799 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300027650|Ga0256866_1002589 | All Organisms → cellular organisms → Bacteria | 4497 | Open in IMG/M |
| 3300027748|Ga0209689_1088103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1628 | Open in IMG/M |
| 3300027835|Ga0209515_10198247 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300027846|Ga0209180_10087161 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300027874|Ga0209465_10160876 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300027875|Ga0209283_10118417 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300027880|Ga0209481_10051639 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300027880|Ga0209481_10414972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium IMCC26134 | 691 | Open in IMG/M |
| 3300027882|Ga0209590_10235663 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300027903|Ga0209488_10054031 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300027909|Ga0209382_10037293 | All Organisms → cellular organisms → Bacteria | 5837 | Open in IMG/M |
| 3300027954|Ga0209859_1010630 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300027961|Ga0209853_1155449 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028381|Ga0268264_10129828 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 2232 | Open in IMG/M |
| 3300028587|Ga0247828_10053057 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300028597|Ga0247820_10089707 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300028597|Ga0247820_10099425 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
| 3300028705|Ga0307276_10016192 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300030006|Ga0299907_10078197 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300030902|Ga0308202_1100800 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031184|Ga0307499_10117126 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031421|Ga0308194_10005528 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300031548|Ga0307408_100151075 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300031548|Ga0307408_100157278 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300031731|Ga0307405_10276733 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031740|Ga0307468_100078989 | All Organisms → cellular organisms → Bacteria | 1865 | Open in IMG/M |
| 3300031833|Ga0310917_10706593 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031903|Ga0307407_10017635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Hyellaceae → Pleurocapsa → unclassified Pleurocapsa → Pleurocapsa sp. PCC 7319 | 3589 | Open in IMG/M |
| 3300031943|Ga0310885_10028876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2147 | Open in IMG/M |
| 3300031945|Ga0310913_10852585 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031947|Ga0310909_10216915 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300031947|Ga0310909_10348785 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300032004|Ga0307414_12313438 | Not Available | 502 | Open in IMG/M |
| 3300032060|Ga0318505_10624437 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032211|Ga0310896_10038935 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300033289|Ga0310914_10161867 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300033815|Ga0364946_008231 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300034172|Ga0334913_008014 | All Organisms → cellular organisms → Bacteria | 2657 | Open in IMG/M |
| 3300034666|Ga0314788_014495 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.48% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.87% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.87% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.87% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.87% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.87% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027362 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1208495961 | 3300002568 | Soil | PGSRLTRDSWMSVMYAEELNSSKSSATLQSTDRHDILGQKSPDFQLSL* |
| Ga0066688_107084651 | 3300005178 | Soil | RDNWVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDLQVSL* |
| Ga0070708_1004034072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQGIDLKRDSWVSVRYAEELNSATSSVTLQRTDRHGILGQKPTTFQLSL* |
| Ga0070706_1017607122 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GIRLRRDSWVSVMYAEELNSGQSSVTLQRTDRHEIVGQKRSHFQLDS* |
| Ga0066692_102920311 | 3300005555 | Soil | LRRDNVVSVLYSEGLNSTKSSVFLQRTDRHGIVGQKSADFQRFL* |
| Ga0066706_101024723 | 3300005598 | Soil | MIIRWVSVRYAEALNSGKSSVTLQRTDRHGILGQKPADFQVSL |
| Ga0068861_1000822712 | 3300005719 | Switchgrass Rhizosphere | MIISGVSVMYAEELNSGKSSVTLQRTDRHGSMGQKSADFQLSL* |
| Ga0068858_1015147371 | 3300005842 | Switchgrass Rhizosphere | MIISWVSVMYAEELNSGKSSVTLQRTDRHGSMGQKSADFQLS |
| Ga0075291_10014923 | 3300005884 | Rice Paddy Soil | MGLTRDSLVSVMYAEELNSAKSSVTLQSTDRHGIVGQKPTDFQVSL* |
| Ga0081455_101499974 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RDSLVSVMYAEELNAITSSVTLQRTDRHGILGQKPSDVQEFL* |
| Ga0066659_102330932 | 3300006797 | Soil | WGIRLRRDSWVSVRYAKELNSGKSSVILQRADRHGILGEKPTHLQVSL* |
| Ga0075428_1001608301 | 3300006844 | Populus Rhizosphere | GIRLRRDNWVSVRYAEELNSTTSSVTLQRADRHGILGQKPPDFQVSL* |
| Ga0075430_1015414412 | 3300006846 | Populus Rhizosphere | ALALRRDTLVSVEYSEELNFTTSSATYQRTNRHGILGQKPSDFQRFL* |
| Ga0075431_1000887585 | 3300006847 | Populus Rhizosphere | MLNRGIRLKRDNWVSVRYAEELNSAKSSGILQRTDRHGILGQKSTDFQLSL* |
| Ga0075431_1001453881 | 3300006847 | Populus Rhizosphere | RMGIRLRRDNWVSVRYAEELNSTTSSVTLQRADRHGILGQKPPDFQVSL* |
| Ga0075431_1002799321 | 3300006847 | Populus Rhizosphere | GIRLTRDSWVSVMYAEALNSAKSSVTLQSTDRHGILGQKSADFQVSL* |
| Ga0075433_118476452 | 3300006852 | Populus Rhizosphere | FLALALRRDTLVSVEYSEELNFTTSSATYQRTNRHGILGQKPSDFQRFL* |
| Ga0075425_1018815741 | 3300006854 | Populus Rhizosphere | DNWVSVMYAEALYAATSSVTLQRTDQLGILGQKPAPFQVSL* |
| Ga0075419_106689611 | 3300006969 | Populus Rhizosphere | MRGRGIRLRRDTLVSVMYAEGLHSAMSSVTLQSTDRHGILGQKS |
| Ga0099791_100753831 | 3300007255 | Vadose Zone Soil | CRGIRLRRDNWVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDFQVSL* |
| Ga0099827_101947752 | 3300009090 | Vadose Zone Soil | GIRLRRDSWVSVMYTEELNSTTSSVTLQSTDRHEILGQKPSHFQVSL* |
| Ga0099827_110592281 | 3300009090 | Vadose Zone Soil | LGIRLTRDSWVSVMYAEDLNSAKSSVTFQGTDRHDILGQQSADFQVSL* |
| Ga0114129_112709661 | 3300009147 | Populus Rhizosphere | RYAEKLNSGKSSVLLQRADRHEILGEKPPDFQVSL* |
| Ga0075423_102227372 | 3300009162 | Populus Rhizosphere | WVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDLQVSL* |
| Ga0105085_11020842 | 3300009820 | Groundwater Sand | VSVMYAEALNSGKSSGTLQRTDRHGILGQKPADLQVSLC |
| Ga0126315_101517422 | 3300010038 | Serpentine Soil | MTTSQLNKRGIRLRRDTLVSVMYAEGLNSAMSSVTLQSTDR |
| Ga0126376_101524531 | 3300010359 | Tropical Forest Soil | VVKPEYKDWGSYLRRDNVVSVLYSEELNSTKSSVFLQRTDRHGIVGQKSSDFQRFL |
| Ga0126379_110067141 | 3300010366 | Tropical Forest Soil | MGIHVTRDSWVSVMYAEELNSGQSSVTLQRTDRHEIVGQKRSHFQRD |
| Ga0137374_102551361 | 3300012204 | Vadose Zone Soil | MHKRGIRLRRDSWVSVMYAEELNSTTSSVTLQRTDRHGILGQKS |
| Ga0137374_104670062 | 3300012204 | Vadose Zone Soil | MECGGIRLRRDSWVSVMYAEELNSATSSVTLQSTDRHGILGQKP |
| Ga0137386_111651012 | 3300012351 | Vadose Zone Soil | DFVGIRLRRDSWVSVRYAEELNSGKSSVTPQRTDRQGILGEKLTDFQVSL* |
| Ga0137361_105728951 | 3300012362 | Vadose Zone Soil | GMGLTRDSLVSVMYAEELNSAKSSVTLQRTDRHGILGQKPTDFQVSL* |
| Ga0137361_111951442 | 3300012362 | Vadose Zone Soil | MIPGGIRVRRDSWVLVMYAEGLNSTTSSGTLQRTDRHGILGQKPADFQVSL |
| Ga0137407_101403952 | 3300012930 | Vadose Zone Soil | LRRDSWVSVMYAEEPNSTTSSVTLQRTDRHEILGQKPAGFQQFPLSLQAQ* |
| Ga0132257_1043314282 | 3300015373 | Arabidopsis Rhizosphere | QEILENPSVGQLWGIRLKRDSVVSVMYPEELDSAKSSATLQRTDRHGILGQKPTDFQVSL |
| Ga0132255_1017203411 | 3300015374 | Arabidopsis Rhizosphere | GIRVRRDNWVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDLQVSL* |
| Ga0182040_103117321 | 3300016387 | Soil | LLSKLMQLRGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0182037_102328872 | 3300016404 | Soil | SGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0184637_101190313 | 3300018063 | Groundwater Sediment | GMGLTRDSLVSVMYPAGLNSAKSSVTLQRTDRHGILGEKPSDFQVSL |
| Ga0184637_105466512 | 3300018063 | Groundwater Sediment | VRMETGIRLRRDNWVSVRYAEELNSGKSSVLLQRADRHEIVGQKP |
| Ga0184637_107944901 | 3300018063 | Groundwater Sediment | LNHVRLVKPVGIRLRRDNWVSVRYAEELNSGKSSVLLQRADRHEIVGQKP |
| Ga0184633_100589271 | 3300018077 | Groundwater Sediment | MHCRGTGLRRDNLVSVMYAEELNSTTSSVTHQRTDRHEILDQK |
| Ga0184629_100533953 | 3300018084 | Groundwater Sediment | SGIRLRRDKWVSVRYAEELNSDKSSVLLQRADRHEILDQKPADFQLSV |
| Ga0184629_104679673 | 3300018084 | Groundwater Sediment | SVRYAEALNSGKSSVTLQRTDRHGILDQKRADFQESL |
| Ga0190265_102495123 | 3300018422 | Soil | RRDSWVSVVYAEELDSAKSSATLQRTDRHEILGQKPTNFQVPL |
| Ga0190268_113256661 | 3300018466 | Soil | RYAEELNSAKSSGILQRTDRHEILDEKSADFQLSL |
| Ga0184645_11554963 | 3300019233 | Groundwater Sediment | MSIAGIRLRRGSWVSVRYAKELNSGKSSATLQRADRQEILGQKPA |
| Ga0193747_10172381 | 3300019885 | Soil | SGIRLRRDNWVSVRYAEELNSAKSSVTLQRTDRHGSVDQKRTDFQVSL |
| Ga0193739_10205691 | 3300020003 | Soil | GIRLRRDSWVSVMYAEELNSATSSVTLQSTDRHGILGQKPTHFQLSL |
| Ga0193697_10403901 | 3300020005 | Soil | CLRRDSLVSVVYAEELNSTTSSVTPRRTDRHEILDQKLADFQESL |
| Ga0179596_100408954 | 3300021086 | Vadose Zone Soil | VTQSNGGSHLRRDNVVSVLYAEELNSTKSSVSLQRTDRHGILGQKSSDFQRFL |
| Ga0179596_101440801 | 3300021086 | Vadose Zone Soil | SREQWKRKAGMGLTRDSLVSVMYAEELNSAKSSVTLQRTDRHGILDQKPANFQLSL |
| Ga0179596_104663892 | 3300021086 | Vadose Zone Soil | HLSRDNLVSVMYAEELSSNQSSATLQRTDRHGILGQKSSDFQLVL |
| Ga0209399_100369601 | 3300025157 | Thermal Springs | CRWGKDRKGKAHLGISLRRDSWVSVMYAEELNAGKSAVTLQRTDRHGILDQKLADFQESL |
| Ga0207684_100863891 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GVGGIRLRRDSWVSVMYAEGLNSDKSSVPFQRTDRHAILGQQPADFQVSL |
| Ga0207662_100552243 | 3300025918 | Switchgrass Rhizosphere | MIISWVSVMYAEELNSGKSSVTLQRTDRHGSMGQKSADFQLSL |
| Ga0207646_102174202 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | CLRKEGIRLRRDSWVSVMYAEGLNSDKSSVPFQRTDRHAILGQQPADFQVSL |
| Ga0207712_101577451 | 3300025961 | Switchgrass Rhizosphere | LVDARARFVTRDSGVSVMYAEELNSAKSSATLQRTDRHGILGQKPAHLQVSL |
| Ga0208776_10055911 | 3300026014 | Rice Paddy Soil | GGMGLTRDSLVSVLYAEELNSAKSSVTLQSTDRHGIVGQKPTDFQVSL |
| Ga0208778_10024361 | 3300026025 | Rice Paddy Soil | RDNVVSVLYAEGLNSTKSSVFLQRTDRHGIVGQTSSDFQRFL |
| Ga0208778_10090992 | 3300026025 | Rice Paddy Soil | WGMGLTRDSLVSVLYAEELNSAKSSVTLQSTDRHGIVGQKPTDFQVSL |
| Ga0207675_1000822693 | 3300026118 | Switchgrass Rhizosphere | MIISGVSVMYAEELNSGKSSVTLQRTDRHGSMGQKSADFQLSL |
| Ga0207675_1013177141 | 3300026118 | Switchgrass Rhizosphere | RRDNWVSVRYAEELNSTTSSVLLQRADRHGILGEKPPDFQVSL |
| Ga0209237_12085201 | 3300026297 | Grasslands Soil | ILGSHLRRDNVVSVLYAEELNSTKSSVSLQRTDRHGILGQKSSDFQRFL |
| Ga0209027_10663741 | 3300026300 | Grasslands Soil | DNLVSVLYSEELNSTKSSVSLQRTDRHGILGQKSSDFQLFL |
| Ga0209153_10306482 | 3300026312 | Soil | MIISWVSVRYAEELNSTTSSVSLQRTDRHGILDQKPADFQRFL |
| Ga0209761_10877621 | 3300026313 | Grasslands Soil | PYLRRDNLVSVLYAEELNSTKSSVFLQRTDRHGILGQKSSDFQRFL |
| Ga0209131_10828233 | 3300026320 | Grasslands Soil | QFLGIRLRRDSWVSVMYAEELNSTKSSGFLQRTDRHGILGQKPADFHLFL |
| Ga0209802_11629301 | 3300026328 | Soil | EKWGIHLRWDNWVSVRYAEELNSGKSSATLQRADRHGILGQKSPNFQVSL |
| Ga0209267_12354481 | 3300026331 | Soil | RGIRLRRDNWVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDLQVSL |
| Ga0208320_10201671 | 3300027362 | Soil | IRVRRDNWVSVMYAEGLNSAKSSVPLQRTDRHGILGQKPADLQVSL |
| Ga0209842_10175731 | 3300027379 | Groundwater Sand | SLVLVMYAEALHSTMSAVTLQRTDRHGILGQQSSYFQVSL |
| Ga0209899_10462292 | 3300027490 | Groundwater Sand | VPGWGIRLRWDNLVSVMYFEELNSAMSAVTRQRTDRHEIVDQKRADFQESL |
| Ga0209874_10223143 | 3300027577 | Groundwater Sand | VMYAEALHSTMSAVTLQRTDRHGILGQQSSYFQVSL |
| Ga0209874_11054021 | 3300027577 | Groundwater Sand | VSVMYFEELNSAMSAVTRQRTDRHEIVDQKRADFQES |
| Ga0209076_10197992 | 3300027643 | Vadose Zone Soil | LGIHLSRDNLVSVMYAEELSSNQSSATLQRTDRHGILGQKSSDFQLVL |
| Ga0256866_10025893 | 3300027650 | Soil | MIINLVSVKYSEELNSITISAIHQRTDRHGILGQKPSDFQRPL |
| Ga0209689_10881033 | 3300027748 | Soil | MDFEGIRIKRDSGVSVVDAEGLNSAKSAGTLQRTDRHGILGQKPPDCPLSL |
| Ga0209515_101982471 | 3300027835 | Groundwater | GGIGLTRDSLVSVRYAEELNSGKSSATLQRTDRHEILDQKPADFQRSL |
| Ga0209180_100871612 | 3300027846 | Vadose Zone Soil | VFAGIRLRRDSWVSVMYTEELNSTTSSVTLQSTDRHEILGQKPSHFQVSL |
| Ga0209465_101608761 | 3300027874 | Tropical Forest Soil | LRRDKWVSVRYAEELNSDKSSVLLQRADRHGILDQKSTDFQLSV |
| Ga0209283_101184172 | 3300027875 | Vadose Zone Soil | KSGTGLRRDNLVSVMYSEELNSTTSSVTHQRTDRHEILDQKLEDFQESL |
| Ga0209481_100516391 | 3300027880 | Populus Rhizosphere | RSYLLHPLGIRLRRDNWVSVRYAEELNSTTSSVLLQRADRHGILGEKPPDFQVSL |
| Ga0209481_104149721 | 3300027880 | Populus Rhizosphere | MRGRGIRLRRDTLVSVMYAEGLHSAMSSVTLQSTDRHGILGQKSS |
| Ga0209590_102356631 | 3300027882 | Vadose Zone Soil | DGVSLDMRGIRLRRDNWVSVRYAEELNSGKSSVTPQRTDRHGILGEKLTDFQVSL |
| Ga0209488_100540314 | 3300027903 | Vadose Zone Soil | MIKLNPGIRLRRDNWVSVRYAEALNSGKSSVTLQRTDRHGILDQKRADFQESL |
| Ga0209382_100372936 | 3300027909 | Populus Rhizosphere | MRGRGIRLRRDTLVSVMYAEGLHSAMSSVTLQSTDRHGILGQKSSG |
| Ga0209859_10106302 | 3300027954 | Groundwater Sand | EPLVPGWIAVSAAVVVPPGIRLRRDSLVSVMYAEGLNSSQSSATYQRTDRHEILGEKSSDFQLSL |
| Ga0209853_11554491 | 3300027961 | Groundwater Sand | FLEISGMGLTRDSLVSVMYAEELNSAKSSVTLQRTDRHGILDQKPAHFQRSL |
| Ga0268264_101298283 | 3300028381 | Switchgrass Rhizosphere | MIINWVSVRYAEELNSGKSSVLLQRADRHGILGQKPANLQRHS |
| Ga0247828_100530571 | 3300028587 | Soil | SGYPILGIHVKRDSEVSVRYAEELNSSQSSVLLQRADRHEILGQKPPGFQLSL |
| Ga0247820_100897071 | 3300028597 | Soil | LEIQGIHVKRDSEVSVRYAEELNSSQSSVLLQRADRHEILGQKPPGFQLSL |
| Ga0247820_100994252 | 3300028597 | Soil | TYIVLLARFVTRDSGVSVMYAEELNSAKSSATLQRTDRHGILGQKPAHLQVSL |
| Ga0307276_100161922 | 3300028705 | Soil | TRDSLVSVMYAEELNSAKSSVTLQRTDRHGILGQKPTDFQVSL |
| Ga0299907_100781973 | 3300030006 | Soil | QNLGIPLSRDNLGSVRYSEELNSGKSSVICQRTDRHGILGQKPSDFQRPL |
| Ga0308202_11008002 | 3300030902 | Soil | SVLYSEGLNSTKSSVFLQRTDRHGIVGQKSSDFQRFL |
| Ga0307499_101171261 | 3300031184 | Soil | RDSWVSVMYAEDLNSAKSSVTFQGTDRHDILGQQSADFQVSL |
| Ga0308194_100055282 | 3300031421 | Soil | MGMGLTRDSLVSVMYAEELNSAKSSVTLQRTDRHGILGQKPTDFQVSL |
| Ga0307408_1001510753 | 3300031548 | Rhizosphere | CYKGTGIRLKRDSVVSVMYPEELDSATSSVTLQRTDRHGILGQKPTDFQVSL |
| Ga0307408_1001572782 | 3300031548 | Rhizosphere | MGLTRDSVVSVMYAEELNSAKSSVTLQRTDRHGILGQKPTDFQVSL |
| Ga0307405_102767331 | 3300031731 | Rhizosphere | PCYKGTGIRLKRDSVVSVMYPEELDSATSSVTLQRTDRHGILGQKPTDFQVSL |
| Ga0307468_1000789892 | 3300031740 | Hardwood Forest Soil | TLARFVTRDSGVSVMYAEELNSAKSSATLQRTDRHGILGQKPAHLQVSL |
| Ga0310917_107065931 | 3300031833 | Soil | VSRLKQIPGWGSHLRRDNLVSVLYAEELNSTKSSVFLQRTDRHEILDQKSA |
| Ga0307407_100176352 | 3300031903 | Rhizosphere | MGLTRDSVVSVMDAEELNSAKSAVTLQRTDRHGIVGQKPTDFQVSL |
| Ga0310885_100288763 | 3300031943 | Soil | ILRGIRLTRDSWVSVMYAEALNSAKSSVTLQSTDRHGILGQKSADFQVSL |
| Ga0310913_108525851 | 3300031945 | Soil | QGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0310909_102169151 | 3300031947 | Soil | LPFVGSHLRRDNLVSVMYAEELNSTKSSGSLQRTDRHEILDQKSADFQRFL |
| Ga0310909_103487851 | 3300031947 | Soil | SSQKNWGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0307414_123134381 | 3300032004 | Rhizosphere | VSVMYATELHSATSSVTPQRTDRQGIVGEKPSDFQ |
| Ga0318505_106244371 | 3300032060 | Soil | LRVTQKSGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0310896_100389351 | 3300032211 | Soil | VIVPTGIRLTRDSWVSVMYAEALNSAKSSVTLQSTDRHGILGQKSADFQVSL |
| Ga0310914_101618672 | 3300033289 | Soil | MQLRGIRLKRDSVVSVMYPEELDSAKSSVTLQRTDRHEILGQKPTDFQLSL |
| Ga0364946_008231_1687_1815 | 3300033815 | Sediment | RDSLVSVMYAEELHSTTSSVTRQRTDRHEILDQKRADFQESL |
| Ga0334913_008014_2400_2516 | 3300034172 | Sub-Biocrust Soil | MSVMYAEGLNSAKSSVTLQSTDRHGILGEKSAYFQVPL |
| Ga0314788_014495_1093_1236 | 3300034666 | Soil | GIRLTRDSWVSVMYAEALNSAKSSVTLQSTDRHGILGQKSADFQVSL |
| ⦗Top⦘ |