Basic Information | |
---|---|
Family ID | F079747 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 48 residues |
Representative Sequence | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRP |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.565 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.435 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.304 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.304 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.33% β-sheet: 34.67% Coil/Unstructured: 56.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 13.91 |
PF02511 | Thy1 | 7.83 |
PF00248 | Aldo_ket_red | 6.09 |
PF00043 | GST_C | 4.35 |
PF14497 | GST_C_3 | 4.35 |
PF02515 | CoA_transf_3 | 4.35 |
PF02798 | GST_N | 2.61 |
PF00496 | SBP_bac_5 | 1.74 |
PF13776 | DUF4172 | 1.74 |
PF01243 | Putative_PNPOx | 1.74 |
PF09084 | NMT1 | 1.74 |
PF12697 | Abhydrolase_6 | 1.74 |
PF04255 | DUF433 | 0.87 |
PF06941 | NT5C | 0.87 |
PF08239 | SH3_3 | 0.87 |
PF02423 | OCD_Mu_crystall | 0.87 |
PF07859 | Abhydrolase_3 | 0.87 |
PF02771 | Acyl-CoA_dh_N | 0.87 |
PF02900 | LigB | 0.87 |
PF01715 | IPPT | 0.87 |
PF01381 | HTH_3 | 0.87 |
PF13417 | GST_N_3 | 0.87 |
PF09587 | PGA_cap | 0.87 |
PF00717 | Peptidase_S24 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 7.83 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 4.35 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 4.35 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 4.35 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.74 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.74 |
COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.87 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.87 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.87 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.87 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.43 % |
Unclassified | root | N/A | 9.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8793110 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
2228664021|ICCgaii200_c0543117 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300001989|JGI24739J22299_10183062 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300003997|Ga0055466_10254316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13 | 530 | Open in IMG/M |
3300004156|Ga0062589_101449163 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300004266|Ga0055457_10176207 | Not Available | 619 | Open in IMG/M |
3300004281|Ga0066397_10112315 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300004480|Ga0062592_101813015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
3300004480|Ga0062592_102015298 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005218|Ga0068996_10048932 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300005294|Ga0065705_10184925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1547 | Open in IMG/M |
3300005294|Ga0065705_11019606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300005295|Ga0065707_10193162 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300005332|Ga0066388_103761527 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300005332|Ga0066388_103872339 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300005332|Ga0066388_104598878 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005332|Ga0066388_108318271 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Ustilaginomycotina → Exobasidiomycetes → Microstromatales → Microstromatales incertae sedis → Pseudomicrostroma → Pseudomicrostroma glucosiphilum | 517 | Open in IMG/M |
3300005440|Ga0070705_100624603 | Not Available | 837 | Open in IMG/M |
3300005441|Ga0070700_100032935 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
3300005545|Ga0070695_100072826 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
3300005615|Ga0070702_100411640 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300005764|Ga0066903_105985536 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006845|Ga0075421_100470864 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300006845|Ga0075421_100910687 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300006845|Ga0075421_102279715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300006846|Ga0075430_100811634 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300006852|Ga0075433_10362532 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300006918|Ga0079216_10662084 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300007076|Ga0075435_100076803 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
3300009012|Ga0066710_104010998 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300009053|Ga0105095_10311122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 866 | Open in IMG/M |
3300009087|Ga0105107_10100827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2034 | Open in IMG/M |
3300009100|Ga0075418_11550419 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300009100|Ga0075418_13060492 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300009156|Ga0111538_11572204 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009156|Ga0111538_14034685 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300009162|Ga0075423_10294232 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300009166|Ga0105100_10898701 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009176|Ga0105242_10035002 | All Organisms → cellular organisms → Bacteria | 4027 | Open in IMG/M |
3300009285|Ga0103680_10626731 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300009553|Ga0105249_11484413 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300010043|Ga0126380_11742816 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300010046|Ga0126384_10592964 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300010047|Ga0126382_10231741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
3300010047|Ga0126382_10613581 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300010304|Ga0134088_10076353 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
3300010359|Ga0126376_11197237 | Not Available | 774 | Open in IMG/M |
3300010359|Ga0126376_12609780 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300010359|Ga0126376_12628163 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300010360|Ga0126372_13024478 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010362|Ga0126377_10640010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1111 | Open in IMG/M |
3300010399|Ga0134127_10068508 | All Organisms → cellular organisms → Bacteria | 3005 | Open in IMG/M |
3300011429|Ga0137455_1108536 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300011443|Ga0137457_1128701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 828 | Open in IMG/M |
3300012034|Ga0137453_1118862 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012228|Ga0137459_1246246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300012884|Ga0157300_1045377 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012948|Ga0126375_12052343 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300014270|Ga0075325_1021239 | Not Available | 1222 | Open in IMG/M |
3300014745|Ga0157377_11739584 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014877|Ga0180074_1083346 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300015170|Ga0120098_1016460 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300015201|Ga0173478_10756350 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300015258|Ga0180093_1072826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300015374|Ga0132255_102349944 | Not Available | 813 | Open in IMG/M |
3300017936|Ga0187821_10307034 | Not Available | 632 | Open in IMG/M |
3300018054|Ga0184621_10259773 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300018083|Ga0184628_10228258 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300018084|Ga0184629_10378513 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300018422|Ga0190265_10295787 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
3300019263|Ga0184647_1188071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300021082|Ga0210380_10299154 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300025002|Ga0209001_1042947 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300025155|Ga0209320_10099435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1334 | Open in IMG/M |
3300025159|Ga0209619_10444917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
3300025159|Ga0209619_10463422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
3300025165|Ga0209108_10351995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
3300025173|Ga0209824_10291041 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300025313|Ga0209431_10972700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 602 | Open in IMG/M |
3300025925|Ga0207650_10557525 | Not Available | 961 | Open in IMG/M |
3300025961|Ga0207712_10638377 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300026014|Ga0208776_1001284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2188 | Open in IMG/M |
3300026023|Ga0207677_12116775 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026062|Ga0208654_1005633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1609 | Open in IMG/M |
3300026067|Ga0207678_10111506 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
3300026075|Ga0207708_10020150 | All Organisms → cellular organisms → Bacteria | 5029 | Open in IMG/M |
3300026095|Ga0207676_10714626 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300026095|Ga0207676_11068573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 797 | Open in IMG/M |
3300026116|Ga0207674_10293026 | Not Available | 1576 | Open in IMG/M |
3300026118|Ga0207675_102663286 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300027360|Ga0209969_1054048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13 | 631 | Open in IMG/M |
3300027639|Ga0209387_1107672 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300027647|Ga0214468_1187514 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300027787|Ga0209074_10083556 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300027909|Ga0209382_10941865 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300028379|Ga0268266_11016540 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1178052 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300031562|Ga0310886_10459719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
3300031716|Ga0310813_10456058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1110 | Open in IMG/M |
3300031716|Ga0310813_10937333 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300031858|Ga0310892_10359952 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300031901|Ga0307406_10391105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1099 | Open in IMG/M |
3300031903|Ga0307407_11498525 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031941|Ga0310912_11127121 | Not Available | 599 | Open in IMG/M |
3300032144|Ga0315910_11164833 | Not Available | 602 | Open in IMG/M |
3300032157|Ga0315912_10043743 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
3300032180|Ga0307471_104349193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300032261|Ga0306920_101185744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1104 | Open in IMG/M |
3300032421|Ga0310812_10141355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
3300033289|Ga0310914_10806837 | Not Available | 837 | Open in IMG/M |
3300033417|Ga0214471_11015381 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300033480|Ga0316620_12355394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium GWA2_57_13 | 529 | Open in IMG/M |
3300033814|Ga0364930_0264043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300034090|Ga0326723_0612190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
3300034164|Ga0364940_0022615 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.96% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.61% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.61% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.74% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.74% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.87% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.87% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.87% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.87% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.87% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.87% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.87% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009285 | Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1um | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_03032140 | 2088090015 | Soil | MEWKEALPLLQENHTGVATSXXXXTVVSTAVLDGKVGFASRPRTIKLKNIQRTGRATLTVIKLDNR |
ICCgaii200_05431171 | 2228664021 | Soil | MEWQEALPLLRENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASR |
JGI24739J22299_101830621 | 3300001989 | Corn Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDXLGFASRPRTVKLKNIQRTGR |
Ga0055466_102543161 | 3300003997 | Natural And Restored Wetlands | MDWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLDGKVGFASRPRTVKLKNIDR |
Ga0062589_1014491631 | 3300004156 | Soil | MEWQEALPLLRENHTGVAISVTPKGRAQSTIVSTAVLDGKLG |
Ga0055457_101762071 | 3300004266 | Natural And Restored Wetlands | MEWKEALPLLQENHTGVAATVSSKGRAQSTIVSTAVLDGKVGVATRPRTVK |
Ga0066397_101123152 | 3300004281 | Tropical Forest Soil | MEWKEALPLLQDNHTGIAISVTPKGRAQSTVVSTALLDGKVGFAS |
Ga0062592_1018130152 | 3300004480 | Soil | MNWQEALPLLQGNHTGVASTITAKGRVQSTIVSTAVLDGKVGVAARPRTVKEKNIGRTGR |
Ga0062592_1020152982 | 3300004480 | Soil | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFAS |
Ga0068996_100489321 | 3300005218 | Natural And Restored Wetlands | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKVGFASRPRTVKLKNIE |
Ga0065705_101849252 | 3300005294 | Switchgrass Rhizosphere | MEWKEALPLLQENHSAVAISVTPKGRAQATVVSTALLDGKLGFASRP |
Ga0065705_110196062 | 3300005294 | Switchgrass Rhizosphere | MNWQEALPLLQGNHTGVASTITAKGRVQSTIVSTAVLDGKVGVA |
Ga0065707_101931622 | 3300005295 | Switchgrass Rhizosphere | MEWKKALPLLQENHSAVAISVTPKGRAQATVVSTALLDGKLGFASRPHTVKVKNIQRTGR |
Ga0066388_1037615273 | 3300005332 | Tropical Forest Soil | MEWKEALPLLQDNHTGVAISVTPKGHAHSTIVSTAVLDGKVGFASRSRTVKLKNIQRT |
Ga0066388_1038723391 | 3300005332 | Tropical Forest Soil | MEWKEALPLLQDNHTGVAISVTPKGRAQSTVVSTALLDGKLAFASRPHTVKVKNIQK |
Ga0066388_1045988781 | 3300005332 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGRAQSTVVSTALLDGKVGFASRSHTVKL |
Ga0066388_1083182711 | 3300005332 | Tropical Forest Soil | MEWKEALPLLRANHTGIAISITAKGHAQSTVVSTAVLDDKLGFASRPRTVKLKNIQ |
Ga0070705_1006246031 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWKEVLPLLRANHTGIAISITAKGHAQSTVVSTAVLDDKLG |
Ga0070700_1000329354 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPMGYAQSTIVSTALLDDKLGF |
Ga0070695_1000728263 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKL |
Ga0070702_1004116401 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASRPRTVKL |
Ga0066903_1059855361 | 3300005764 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGRAQSTVVSTALLDGKVGFASRS |
Ga0075421_1004708641 | 3300006845 | Populus Rhizosphere | MEWKKALPLLQENHSAVAISVTPKGRAQATVVSTALLDGKLGFASRP |
Ga0075421_1009106871 | 3300006845 | Populus Rhizosphere | MEWKEALPLLQENHTGVAISITPKGRAQSTIVSTAVLDGKLGFAS |
Ga0075421_1022797152 | 3300006845 | Populus Rhizosphere | MEWKEAFPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPRTVK |
Ga0075430_1008116342 | 3300006846 | Populus Rhizosphere | MEWKEALPLLRENHAGVAISVTPNGHAQSTVVSTAVLDDKLGFAS |
Ga0075433_103625321 | 3300006852 | Populus Rhizosphere | MEWKEALPLLQENHSGVAISITARGHAQSTVVSTAVLDDKLGFASRPR |
Ga0079216_106620842 | 3300006918 | Agricultural Soil | MEWKEALPLLQENHTGVAISVMPNGRAQSTVVSTAVLDGKVGFASRGWTVNIKNIQRTGR |
Ga0075435_1000768034 | 3300007076 | Populus Rhizosphere | MEWKEALPLLRENHCGVAISVTPRGHAQSTVVSTAVLDDKLGFASRPRTVKL |
Ga0066710_1040109981 | 3300009012 | Grasslands Soil | MEWKEALPLLQGNHTGVAIAVTPMGRAQATDVSTAVLDGKVGFASRGYTVK |
Ga0105095_103111222 | 3300009053 | Freshwater Sediment | MDWKQALPLLQDNHTGVAVSVTPKGRAQATVVSTAVLDGK |
Ga0105107_101008275 | 3300009087 | Freshwater Sediment | MEWKEALPLLQENHTGVATSVTPNGRAQSTIVSTAVLDGKVGFASRPRTVKLKNI |
Ga0075418_115504192 | 3300009100 | Populus Rhizosphere | MEWKEALPLLRENHAGVAISVTPKGHAQSTVVSTAVLDDKLGFASRPR |
Ga0075418_130604921 | 3300009100 | Populus Rhizosphere | MEWQEALPLLRENHTGVAISVTPKGRAQSTIVSTAVLDGKLGF |
Ga0111538_115722042 | 3300009156 | Populus Rhizosphere | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPR |
Ga0111538_140346852 | 3300009156 | Populus Rhizosphere | MEWKEALPLLQENHTGVAISVTPKGCAQSTVVSTAVLDGKVGFASRPHTVKVKNIQRTG |
Ga0075423_102942321 | 3300009162 | Populus Rhizosphere | MEWKEALPLLRENHCGVAISVTPRGHAQSTVVSTAVL |
Ga0105100_108987011 | 3300009166 | Freshwater Sediment | MEWKEALPLLQKNHTGVAVSVTPKGRAQATIVSTAVLDGKVGVATRPLTVKAKNIE |
Ga0105242_100350025 | 3300009176 | Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPMGYAQSTIVSTALLDDKLG |
Ga0103680_106267311 | 3300009285 | Groundwater | MEWNKALPLLQESHTGVAVTITAKGRAQSTIVSTAVLDGKLGFASRRH |
Ga0105249_114844132 | 3300009553 | Switchgrass Rhizosphere | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPRTVKVKNIQ |
Ga0126380_117428161 | 3300010043 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGRAQSTVVSTALL |
Ga0126384_105929642 | 3300010046 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGHAQSTVVSTALLDGKLAFA |
Ga0126382_102317413 | 3300010047 | Tropical Forest Soil | MEWKEALPLLQDNHTGIAISVTPKGRAQSTVVSTALLDGKVGFASRS |
Ga0126382_106135811 | 3300010047 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGRAQSTVVSTALLDGKVGFASRSH |
Ga0134088_100763531 | 3300010304 | Grasslands Soil | MEWKEALPLLQGNHTGVAISVTPKGRAQATVVSTA |
Ga0126376_111972372 | 3300010359 | Tropical Forest Soil | MEWKEALPLLQDNHTGVAISVTPKGRAQSTVVSTALLDGKLAFASRPHTVKVKNIQ |
Ga0126376_126097801 | 3300010359 | Tropical Forest Soil | MEWKEAFPLLQDNHTGVAISVTPKGHAHSTVVSTAVLDGKVGFASRSHTV |
Ga0126376_126281631 | 3300010359 | Tropical Forest Soil | MEWKEALPLLQANHTGVAISVTPKGRAQSTIVSTAVLEGKV |
Ga0126372_130244781 | 3300010360 | Tropical Forest Soil | MEWKEAFPLLQDNHTGVAISVTPEGRAQSTVVSTALLDGKVGFASRSHTVKLKNIQ |
Ga0126377_106400101 | 3300010362 | Tropical Forest Soil | MEWKEALPLLQNNHTGVAISVTPKGRAQSTVVSTALLDGKVGFASRSHTVK |
Ga0134127_100685081 | 3300010399 | Terrestrial Soil | MDWKEALPLLQENHTGVAISVTPKGRAQATIVSTAVLDGKVGFASRDYTVKVKNIQRTGR |
Ga0137455_11085363 | 3300011429 | Soil | MDWKEVLPLLQDNHTGVAISVTPKGRAQSTIVSTAVLD |
Ga0137457_11287011 | 3300011443 | Soil | MEWKEALPLLQENHTGVAATVTAKGRAQATIVSTA |
Ga0137453_11188621 | 3300012034 | Soil | MEWKEALPLLQENHTGVAISVTSKGRAQSTIISTAVLDDKLGFASRGYTVKV |
Ga0137459_12462461 | 3300012228 | Soil | MEWKEALPLLQENHTGVAISVTPKGRAQATVVSTAVLDGKVGFASRG |
Ga0157300_10453772 | 3300012884 | Soil | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASRPRTVKLKNIQ |
Ga0126375_120523432 | 3300012948 | Tropical Forest Soil | MEWKEALPLLQDNHTGVAISVTPKGHAQSTVVSTAV |
Ga0075325_10212393 | 3300014270 | Natural And Restored Wetlands | MDWKEALPLLQNNHTGVAVSVTPQGRAHSTIVSTAVL |
Ga0157377_117395841 | 3300014745 | Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTAL |
Ga0180074_10833461 | 3300014877 | Soil | MEWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLD |
Ga0120098_10164602 | 3300015170 | Fossill | MEWKEALPLLQENHTGVAISVTPKGRAQATVVSTALLDGKLGFASRGYTVKVKNI |
Ga0173478_107563501 | 3300015201 | Soil | MEWKEALPLLQENHTGVATSITRDGRAQSTVVSTAV |
Ga0180093_10728262 | 3300015258 | Soil | MEWKEALPLLQGNHTGVAASVTPKGRAQATIVSTALL |
Ga0132255_1023499442 | 3300015374 | Arabidopsis Rhizosphere | MEWKAALPLLRENHTGVAISVTPKGYAQSTIVSTALLDDKLGFASRPRTV |
Ga0187821_103070341 | 3300017936 | Freshwater Sediment | MEWKAALPLLRENHTGVAISVTPKGHAQSTIVSTALLDDK |
Ga0184621_102597732 | 3300018054 | Groundwater Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKVGFASRPRTVKLKNIQR |
Ga0184628_102282582 | 3300018083 | Groundwater Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPRTVKVKNIQWTGRATIT |
Ga0184629_103785131 | 3300018084 | Groundwater Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLDGKLGFASRGYTVKVKNI |
Ga0190265_102957872 | 3300018422 | Soil | MEWKEALPLLQENHTGVATSVTANGRAQSTVVSTAVLDDKVGFASRPR |
Ga0184647_11880711 | 3300019263 | Groundwater Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRP |
Ga0210380_102991542 | 3300021082 | Groundwater Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDG |
Ga0209001_10429472 | 3300025002 | Soil | MEWKEALPLLQENHTGVAISVTPKGRAQATVVSTAVLDGKVGFASRGYTVKVKN |
Ga0209320_100994351 | 3300025155 | Soil | MEWKEALPLLQENHTGVAISVTPRGRAQATVVSTAV |
Ga0209619_104449172 | 3300025159 | Soil | MEWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLDGKLGFASRGYTAKV |
Ga0209619_104634221 | 3300025159 | Soil | MEWSEALPLLQENHTGVAISVTPKGRAQATVVSTAVLDGKVGFASR |
Ga0209108_103519951 | 3300025165 | Soil | MEWSEALPLLQENHTGVAISVTPKGRAQATVVSTAVLDGKVGF |
Ga0209824_102910411 | 3300025173 | Wastewater | MEWKEALPLLQKNHTGVAISVTPKGRAQATVVSTAVLDGKVGFASRGY |
Ga0209431_109727002 | 3300025313 | Soil | MEWKEALPLLQENHTGVAISVTSKGRAQATVVSTAVLDGKVGFASRGYTVKVKNI |
Ga0207650_105575251 | 3300025925 | Switchgrass Rhizosphere | MEWKEVLPLLRANHTGIAISITAKGHAQSTVVSTAVLDDKLGFASRPR |
Ga0207712_106383771 | 3300025961 | Switchgrass Rhizosphere | MEWKEAIPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPRTVKVK |
Ga0208776_10012841 | 3300026014 | Rice Paddy Soil | MEWKEALPLLQENHTGVATSVTPNGRAQSTIVSTAVLDGKVGFASRPRTVK |
Ga0207677_121167751 | 3300026023 | Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDD |
Ga0208654_10056333 | 3300026062 | Natural And Restored Wetlands | MEWKEALPLLQENHTGVAISVTAKGRAQATVVSTAVLDGKVG |
Ga0207678_101115063 | 3300026067 | Corn Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASRPRT |
Ga0207708_100201506 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASRPRTVKLKNIQRTGR |
Ga0207676_107146262 | 3300026095 | Switchgrass Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASRPRTVKLKNI |
Ga0207676_110685731 | 3300026095 | Switchgrass Rhizosphere | MNWQEALPLLQGNHTGVASTITAKGRVQSTIVSTAVLDGKV |
Ga0207674_102930261 | 3300026116 | Corn Rhizosphere | MEWKEVLPLLRANHTGIAISITAKGHAQSTVVSTAVLDDKLGFA |
Ga0207675_1026632862 | 3300026118 | Switchgrass Rhizosphere | MEWKEALPLLRENHTGVAISVTPKGHAQSTIVSTALLDDKLGFA |
Ga0209969_10540481 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MEWKEALPLLQENHTGVAVSVTPKGRAQSTIVSTAVLDGKVGFASRPRTVKLKNIQRT |
Ga0209387_11076721 | 3300027639 | Agricultural Soil | MEWKEALPLLQENHTGVAISVTPKGRAQATIVSTAVLDGKVGFAS |
Ga0214468_11875142 | 3300027647 | Soil | MEWKEALPLLQESHTGVAISVTPKGRAQSTIVSTAVLDGKVGFASRGYTVKVKNI |
Ga0209074_100835561 | 3300027787 | Agricultural Soil | MEWKAALPLLRENHTGVAISVTPKGHAQSTIVSTALLDDKLGFASRPRTVKLKNIQRTG |
Ga0209382_109418652 | 3300027909 | Populus Rhizosphere | MEWKEAFPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKLGFASRPRTVKVKNIQRTG |
Ga0268266_110165402 | 3300028379 | Switchgrass Rhizosphere | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLG |
(restricted) Ga0255312_11780521 | 3300031248 | Sandy Soil | MEWKEALPLLQDNHTGIAISVTPKGRAQSTVVSTAVLDGKVGFASRGHTVKVKNIQRT |
Ga0310886_104597192 | 3300031562 | Soil | MNWQEALPLLQQNHTGVASTITPKGRVQSTIVSTAVLDGKVGVAARPRTVKEKNIGRTGRAT |
Ga0310813_104560582 | 3300031716 | Soil | MEWKEALPLLKDHHTGVAISVTSQGRAQSTIVSTAVLDDKIGFALRPR |
Ga0310813_109373332 | 3300031716 | Soil | MEWKAALPLLRENHTGVAISITPKGYAQSTIVSTALLDDKLGFASR |
Ga0310892_103599522 | 3300031858 | Soil | MEWKAALPLLRENHTGVAISVTPKGHAQSTIVSTALLDD |
Ga0307406_103911051 | 3300031901 | Rhizosphere | MNWQEALPLLQQNHTGVASTITPKGRVQSTIVSTAVLDGKVGVAA |
Ga0307407_114985252 | 3300031903 | Rhizosphere | MEWKEALPLLQENHTGVVTSITSDGRAQSTVVSTAVLDGK |
Ga0310912_111271212 | 3300031941 | Soil | MEWKEALPLLRANHTGIAISITAKGHAQSTVVSTAVLDDKLGFAS |
Ga0315910_111648331 | 3300032144 | Soil | MNWQEALPLLQQNHTGVASTITPKGRVQSTIVSTAVLDGKVGVAARPRTVKEKNIGRTGRATIT |
Ga0315912_100437434 | 3300032157 | Soil | MNWQEALPLLQNNHTGVAATVTAKGRAQATIVSTAVLDDKV |
Ga0307471_1043491931 | 3300032180 | Hardwood Forest Soil | MEWKEALPLLQGNHSGVAISVTPKGRAQSTVVSTAVLDGKVGFASRPHTVKVKNIQRTG |
Ga0306920_1011857442 | 3300032261 | Soil | MEWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLDGKLGFA |
Ga0310812_101413552 | 3300032421 | Soil | MEWKEALPLLKDHHTGVAISVTSQGRAQSTIVSTAVLDDKIGFASRPRT |
Ga0310914_108068372 | 3300033289 | Soil | MEWKEALPLLRANHTGIAISITAKGHAQSTVVSTAVLDYKLGFASRPRT |
Ga0214471_110153811 | 3300033417 | Soil | MEWKEAFPLLQANHTGVAISVTPKGRAQSTIVSTAVLDGKVGFASRP |
Ga0316620_123553942 | 3300033480 | Soil | MDWKEALPLLQENHTGVAISVTPKGRAQSTIVSTAVLDGKI |
Ga0364930_0264043_2_136 | 3300033814 | Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTVVSTAVLDGKLGFAS |
Ga0326723_0612190_2_163 | 3300034090 | Peat Soil | MNWQEALPLLQGHHTGVASTITPKGRVQSTIVSTAVLDGKVGVAARPRTVKEKN |
Ga0364940_0022615_1_105 | 3300034164 | Sediment | MEWKEALPLLQENHTGVAISVTPKGRAQSTIVSTA |
⦗Top⦘ |