| Basic Information | |
|---|---|
| Family ID | F079368 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AGLHKARPAPIDVGALARYDRPLPDLADYDTLLSGPCAGTA |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.59 % |
| % of genes near scaffold ends (potentially truncated) | 94.83 % |
| % of genes from short scaffolds (< 2000 bps) | 96.55 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.862 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (8.621 % of family members) |
| Environment Ontology (ENVO) | Unclassified (13.793 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 91.38 |
| PF13586 | DDE_Tnp_1_2 | 0.86 |
| PF01609 | DDE_Tnp_1 | 0.86 |
| PF00665 | rve | 0.86 |
| PF01863 | YgjP-like | 0.86 |
| PF01527 | HTH_Tnp_1 | 0.86 |
| PF00872 | Transposase_mut | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 91.38 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.86 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.86 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.86 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.86 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.86 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.86 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.86 % |
| All Organisms | root | All Organisms | 24.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.17% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 5.17% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.59% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.72% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.86% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.86% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001409 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013097 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06) | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026899 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033989 | Biocrust microbial communities from Mojave Desert, California, United States - 20HNC | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| 3300034349 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_18 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034781 | Biocrust microbial communities from Mojave Desert, California, United States - 31SMC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12704J13340_10087591 | 3300001170 | Forest Soil | KARPVPIDVGGLARYDRPMPSVVDYDTLLISTPCVGSA* |
| C688J13580_10071353 | 3300001205 | Soil | YLLIEAWLHKAEPEPIDVGALARYDRPLPDLADYDTLLSAPCAGTA* |
| JGI20185J14861_10122862 | 3300001409 | Arctic Peat Soil | AAVRYLLTEAGLHKAKPEPIDVGALARYDRPLPNLADYDTLLSGPCAGTA* |
| JGI24739J22299_100779982 | 3300001989 | Corn Rhizosphere | EAALHKAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA* |
| JGIcombinedJ26739_1017726552 | 3300002245 | Forest Soil | LHKARPGPVDVGALARYDRPLPNLADYDTLLSGPCAGTA* |
| C688J35102_1191140451 | 3300002568 | Soil | VRYLLGEVGLHKARPATVDVGELARYDRPMPGVADYDTLLLSGPCAGRA* |
| C688J35102_1199071152 | 3300002568 | Soil | EAALHKAQPMPVDVGELARYDRPMPGVADYDTLLVSSPCAGRA* |
| Ga0065715_104065421 | 3300005293 | Miscanthus Rhizosphere | AALHKAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA* |
| Ga0070714_1024387052 | 3300005435 | Agricultural Soil | VRYLLTEAGLRKARAVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA* |
| Ga0070679_1020894481 | 3300005530 | Corn Rhizosphere | TEAGLHKVPQAPVDVGALARYDRPLPDLADYDTLLTGPCAGTA* |
| Ga0070735_105617791 | 3300005534 | Surface Soil | KGEPAAIDVGELARYDRPLPTMAEYDVLLSGACAGTA* |
| Ga0068854_1006994441 | 3300005578 | Corn Rhizosphere | EASLQRAPAAPIDVGELARYDRPLPSVADYDTLLLSTPCAGTA* |
| Ga0070763_108950061 | 3300005610 | Soil | KAKPEPIDVGALARYDRPLPDLADYDTLLSGPCVGTA* |
| Ga0068851_106275152 | 3300005834 | Corn Rhizosphere | AGAVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA* |
| Ga0068858_1020549651 | 3300005842 | Switchgrass Rhizosphere | EAALHKARPEPVDVGALARYDRPLPNLADYDTLLVSTPCAGTA* |
| Ga0075029_1008689831 | 3300006052 | Watersheds | ARPAPIDVGALARYDRPLPDLADYDTLLSGPCAGTA* |
| Ga0079219_100839043 | 3300006954 | Agricultural Soil | MRIAAAVRYLLTEASLHKAEPEPIDVGALVRYDRPLPDLADYDT |
| Ga0105857_10857381 | 3300009650 | Permafrost Soil | RPVAVDVGALARYDRPLPNLADYDTLLVSTPCAGSA* |
| Ga0126314_111158101 | 3300010042 | Serpentine Soil | VRYLLTEAGLHKARPEPIDVGALVRYDRAVPNLADYDTLLSGPCAGTA* |
| Ga0126314_114081062 | 3300010042 | Serpentine Soil | PAPVDVGELARYDRPVPSVADYDTLLLSGPCAGTA* |
| Ga0126311_100870251 | 3300010045 | Serpentine Soil | TKPEPIDVGALARYDRPLPDLADYDTLLSAPCAGSA* |
| Ga0126306_108302062 | 3300010166 | Serpentine Soil | LHKARPAPVDVGELARYDRPVPSVADYDTLLLSGPCAGRA* |
| Ga0134125_114478371 | 3300010371 | Terrestrial Soil | LLTEAGLRKGAPAAIDVGELARYDRPLPTMAEYDVLLSGACAGTA* |
| Ga0126381_1016187081 | 3300010376 | Tropical Forest Soil | AVRYLLTEAPLHKLRRDPIDVGTLARYDRPMPDLGDYDTLLSGSCAGTA* |
| Ga0134126_115293381 | 3300010396 | Terrestrial Soil | ARPEPVDVGMLARYDRPLPTLADYDTLLSGPCAGTA* |
| Ga0134126_122887732 | 3300010396 | Terrestrial Soil | LTEAGLRKARAVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA* |
| Ga0126359_14765831 | 3300010869 | Boreal Forest Soil | RYLLTEAGLHKARAEPVDVGALARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0120157_10708142 | 3300011994 | Permafrost | MQTEKGSVEAAVRYLLTEAGLHKARPDPVDVGVLARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0120152_10554861 | 3300012011 | Permafrost | AGLHKARPDPVDGGVLARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0120159_10658633 | 3300012014 | Permafrost | PDPVDVGVLARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0164307_104526861 | 3300012987 | Soil | EASLHKAQPAPIDVGTLARYDRPLPDLADYDMLLSAPCAGNA* |
| Ga0136639_102878981 | 3300013097 | Polar Desert Sand | AALHKARPLPVDVGDLARYDRPMPSVADYDTLLVSSPCVGRA* |
| Ga0120135_10770452 | 3300014054 | Permafrost | AGLHKARPEPVDVGTLARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0120149_12225522 | 3300014058 | Permafrost | GLHKARPDPVDVGVLARYDRPLPNLADYDTLLSGPCAGTA* |
| Ga0181529_106747721 | 3300014161 | Bog | DPVDVGELARYDRPLPDLADYDTMLFSTPCAGTA* |
| Ga0157376_129236581 | 3300014969 | Miscanthus Rhizosphere | AVRYLLGEAGLHKARPATVDVGALARYDRPMPGVAEYDTLLVSSPCAGRA* |
| Ga0137414_12299872 | 3300015051 | Vadose Zone Soil | LLTEAGLHKGQAYAIDVGELARYDRPMPTMAEYDVLLLAPCVGTA* |
| Ga0137403_115381701 | 3300015264 | Vadose Zone Soil | LHKARPEPVDVGALARYDRPLPNLADYDTLLVSTPCLGTA* |
| Ga0134072_100426183 | 3300015357 | Grasslands Soil | AAVRYRLSEASLRKAEPIDVGALVRYDRPLPDLADYDTFLSAPCAGNA* |
| Ga0182033_111139902 | 3300016319 | Soil | TEASLQRAPAALIDVGELARYDRPLPSVADYDTLLRGTPCAGTA |
| Ga0136617_106728202 | 3300017789 | Polar Desert Sand | AVRYLLGEAGLHKARPDPIDVGALARYDRPMPTVADYDMLLSSRPCAGAAG |
| Ga0066667_105233832 | 3300018433 | Grasslands Soil | EPHAIDVGELARYDRPLPTMAEYDVLLSGACAGTA |
| Ga0190273_109655992 | 3300018920 | Soil | GEAALHKPLPMAVDVGELARYDRPMPSVADYDTLMPSSPCAGRA |
| Ga0210401_111754892 | 3300020583 | Soil | PVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA |
| Ga0210386_104163013 | 3300021406 | Soil | PEPVDVGALARYDRPLPNLADYDTLLVSTPCAGTA |
| Ga0210391_105506112 | 3300021433 | Soil | VRYLLTEAGLHKARPVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA |
| Ga0224549_10365461 | 3300022840 | Soil | EAGLHKTHPEPINVGELARYDRPPSNFADYDMLLRGQCVGNA |
| Ga0247743_10173722 | 3300023067 | Soil | QPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA |
| Ga0247794_100152143 | 3300024055 | Soil | LTEASLHKAEPEPIDVGALVRYDRPLPDLADYDTLLSAPCAGNA |
| Ga0209697_102362371 | 3300025316 | Freshwater Lake Hypolimnion | PDPVDVGELARYDRPLPDLADYDTLLLSTPCAGTA |
| Ga0210120_10367791 | 3300025556 | Natural And Restored Wetlands | AVRYLLTQAGLHKVRPEPIDVGVLARYDRPLPDLAAYDTLLSGPCAGTA |
| Ga0207647_107665492 | 3300025904 | Corn Rhizosphere | LLGEAALHKAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA |
| Ga0207693_103715253 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LHKAQPAPIDVGTLARYDRPLPDLADYDMLLSAPCAGNA |
| Ga0207652_118662592 | 3300025921 | Corn Rhizosphere | TEAGLHKVPQAPVDVGTLARYDRPLPDLADYDTLLTGPCAGTA |
| Ga0207686_114413972 | 3300025934 | Miscanthus Rhizosphere | GLHKARPATIDVGALARYDRPMPGVAEYDTLLVSSPCAGRA |
| Ga0207679_114260291 | 3300025945 | Corn Rhizosphere | QPMPIDVGALARYDRPMPSVADYDTLLLSSPCAGRA |
| Ga0207679_116080231 | 3300025945 | Corn Rhizosphere | RKAGAVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA |
| Ga0207641_113299322 | 3300026088 | Switchgrass Rhizosphere | VLRKAEPEPIDVGALARYDRPLPDLADYDTLLSAPGAGTA |
| Ga0207683_120828211 | 3300026121 | Miscanthus Rhizosphere | DVAAVRYLLTEAGLRKAGAVPIDVGVLARYDRPMPSVVDYDTLLISTPCVGSA |
| Ga0207746_10099752 | 3300026865 | Tropical Forest Soil | PAAPIDVGELARYDRPLPSVADYDTLLLSTPCAGTA |
| Ga0207805_10224891 | 3300026887 | Tropical Forest Soil | APAAPIDVGELARYDRPLPSVADYDTLLLSTPCAGTA |
| Ga0209326_10124552 | 3300026899 | Forest Soil | RYLLTEASLHKAEPEPIDVGALVRYDRRLPDLADYDTLLSAPCAGNA |
| Ga0208986_10246222 | 3300027031 | Forest Soil | TETGLHKAKPALIDVGALARYDRPMPSVADYDTLLTSTPCVGTA |
| Ga0208996_10236132 | 3300027257 | Forest Soil | AGLHKARPAPIDVGALARYDRPLPDLADYDTLLSGPCAGTA |
| Ga0208996_10486631 | 3300027257 | Forest Soil | VAAVRYLLTEAGLHKAKPEPIDVGALVRYDRPLPNLADYDMLLSGPCAGTA |
| Ga0208999_10702231 | 3300027303 | Forest Soil | KPALIDVGALARYDRPMPSVADYDTLLISTPCVGTA |
| Ga0209656_101774971 | 3300027812 | Bog Forest Soil | LLTEAGLHKARPEPVDVGMLARYDRPLPTLADYDTLLSGPCAGTA |
| Ga0207428_103653462 | 3300027907 | Populus Rhizosphere | AVRYLLGEAALHKAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA |
| Ga0209526_109443171 | 3300028047 | Forest Soil | RYLLTEAGLRKARPEPIDVGALARYDRPVPGMADYDTLLVSTPCAGNA |
| Ga0268264_107760892 | 3300028381 | Switchgrass Rhizosphere | GEAALHKAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA |
| Ga0304729_12460881 | 3300028392 | Freshwater Lake | GQAGLQKAPPVPVDVGRLARYDRPMPSVADYDTLLPGSRCVGTA |
| Ga0302301_10606631 | 3300028731 | Palsa | HKARPDPIDVGALARYDRPMPSIADYDALLISTPCVGTA |
| Ga0302214_10355281 | 3300028736 | Fen | TEAGLHKARPEPVDVGVLARYDRPPPSLADYDTLLSGPCAGTA |
| Ga0307318_101678162 | 3300028744 | Soil | RYLLTEAGLHRARPNPVDVGVLARYDRPLPNLADYDTLLSGPCAGTA |
| Ga0302201_101465983 | 3300028785 | Bog | KARAEPVDVGELARYDRPMPSLADYDTLLTAPCQGRA |
| Ga0307503_101308904 | 3300028802 | Soil | PMPVDVGALARYDRPMPSVADYDTLLISSPCAGRA |
| Ga0302218_101655631 | 3300028863 | Palsa | RYLLTEAGLHKTHPEPINVGELARYDRPPSNFADYDMLLRGQCVGNA |
| Ga0302229_101882321 | 3300028879 | Palsa | LLTEAGLHKARPEPIDVGALARYDRPLPNLADYDTLLSGPCAGTAW |
| Ga0302200_103901512 | 3300028909 | Bog | YLLNEAGLNKARAEPVDVGELARYDRPMPSLADYDTLLTAPCQGRA |
| Ga0311358_109071191 | 3300029915 | Bog | GAVRYLLTEAGLNKARAEAIDVGELARYDRPMPSVADYDALLTAPCLGHA |
| Ga0311363_107080711 | 3300029922 | Fen | EAGLHKARPVAVDVGALARYDRPMPDMADYDTLLVSTPCVGTA |
| Ga0311328_106330971 | 3300029939 | Bog | AALHKARPVAVDVGALARYDRPMPDMADYDTLLVSTPCAGTA |
| Ga0311365_114702111 | 3300029989 | Fen | YLLTEAGLHKARPELIDVGALARYDRPLPDLADYDTLLMGPCAGTA |
| Ga0311338_109187362 | 3300030007 | Palsa | VRYLLTEAALQKERPNAIDVGELARYDRPMPTLAEYDVLLSGPCAGTA |
| Ga0302270_106286812 | 3300030011 | Bog | EAGLSKVQPVPIDVGELARYDRPMPSVADYDALLTAPCLGHA |
| Ga0311348_104701462 | 3300030019 | Fen | LHKPHPDPIDVGELARYDRPTPSLVDYDTLLLGPCVGSA |
| Ga0311348_108052661 | 3300030019 | Fen | PDPVDVGELARYDQPLPDLADYDTLLLSTPCAGTA |
| Ga0311344_110744532 | 3300030020 | Bog | GQPYTIDVGELARYDRPMPTTAEYDVLLFGPCAGTA |
| Ga0302274_101868612 | 3300030041 | Bog | LLTEAGLHKGQPYAIDVGELARYDRPMPTMAEYDVLLSAPCVGTA |
| Ga0311360_104570412 | 3300030339 | Bog | GLHKARPEPVDVGVLARYDRPPPSLADYDTLLSGPCAGTA |
| Ga0268243_10271322 | 3300030510 | Soil | VRYLLSEAALHKALPMAVDVGELARYDRPMPSVADYDTLLLSSPCAGRA |
| Ga0302275_104021462 | 3300030518 | Bog | YLLTEAGLHKARPVAVDVGALARYDRPMPDMADYDTLLVSTPCVGTA |
| Ga0265760_100726341 | 3300031090 | Soil | ARAEPVDVGALARYDRPLPNLADYDTLLSGPCAGTA |
| Ga0302323_1031425141 | 3300031232 | Fen | HTARPELIDVGALARYDRPLPDLADYDTLLMGPCAGTA |
| Ga0272427_11500021 | 3300031454 | Rock | VAAVRYLLTEAGLHKAQPDPVDVGALARYDRPLPTTADYDVLLLSSPCVGTA |
| Ga0272437_12689632 | 3300031472 | Rock | VRYLLTEAGLHKAQPDPVDVGALARYDRPLPTTADYDVLLL |
| Ga0170818_1050362601 | 3300031474 | Forest Soil | RVPAAPIDVGELARYDRPLPSVADYDTLLLSTPCVGTA |
| Ga0302320_110767251 | 3300031524 | Bog | EAGLHKARPIAVDVGALARYDRPMPDLADYDTLLVSTPCAGTA |
| Ga0310887_104810591 | 3300031547 | Soil | RPATIDVGALARYDRPMPGVAEYDTLLVSSPCAGRA |
| Ga0307474_102976531 | 3300031718 | Hardwood Forest Soil | KARAEPVDVGALARYDRPLPNLADYDTLLSGPCAGTA |
| Ga0306917_101025295 | 3300031719 | Soil | TEASLQRAPVAPIDVGELARYDRPLPSVTDYDTLLRCTPCVGTA |
| Ga0306925_107680842 | 3300031890 | Soil | PRPDPIDVGTLARYDRPMPDLGDYDTLLSGPCAGTA |
| Ga0310884_107655832 | 3300031944 | Soil | KAQPMPIDVGALARYDRPMPSVADYDTLLVSSPCAGRA |
| Ga0306926_117205401 | 3300031954 | Soil | TASALRKATPELIDVGELARYDRPIPTLADYDELLSARVA |
| Ga0308176_126345421 | 3300031996 | Soil | RSTPVDIGELARYDRPMPSVADYDTLLLSGPCAGRA |
| Ga0307471_1039474711 | 3300032180 | Hardwood Forest Soil | CDVAAVRYLLTEASLHKAHPAPIDVGALARYDRPLLDLADYDTLLSAPCAGTA |
| Ga0306920_1008093453 | 3300032261 | Soil | TEASLQRAPAAPIDVGELARYDRPLPSVADYDTLLLSTPCAGTA |
| Ga0334924_014727_1_120 | 3300033989 | Hypolithic Biocrust | HKARPAPVDVGELARYDRPVPGVADYDTLLLSGPCAGRA |
| Ga0370489_0059857_17_166 | 3300034127 | Untreated Peat Soil | VRYLLTEAGLHKARPEPVNVGALARYDRSLPNLADYDTLLVSTPCAGTP |
| Ga0370494_003029_3978_4142 | 3300034130 | Untreated Peat Soil | MIASAYSYLLTEAGLHKARPVAVDVGALARYDRPMPDMADYDTLLVSTPCVGTA |
| Ga0370509_0208559_1_159 | 3300034159 | Untreated Peat Soil | VAAVRYRLAEAGLHKTPPVAVDVGALARYDRPMPSVADYDTLLHSSPCAGTA |
| Ga0370503_0028980_1022_1162 | 3300034196 | Untreated Peat Soil | MLTEAGLHKARPIVVDVGALARYDRPMPDLADYDTLLVSTPCAGTA |
| Ga0370503_0269374_507_617 | 3300034196 | Untreated Peat Soil | PPVAVDVGALARYDRPMPSVADYDTLLHSSPCAGTA |
| Ga0370504_0036207_1117_1251 | 3300034349 | Untreated Peat Soil | LTEAGLHKARPELIDVGALVRYDRPLPDLADYDTLLMGPCAGTA |
| Ga0370545_096836_2_136 | 3300034643 | Soil | TEASLQRAPATPIDVGELARYDRPLPSVADYDTLLVSTPCAGTA |
| Ga0334935_161366_505_618 | 3300034781 | Biocrust | ARPAPVDVGELARYDRPVPGVADYDTLLLSGPCVGTA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |