


| Basic Information | |
|---|---|
| Family ID | F079278 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VIASKGGASEPPDTLLPGKAGGAVAVRRTLATTICRIADP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.41 % |
| % of genes from short scaffolds (< 2000 bps) | 93.97 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.793 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.828 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.241 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 83.62 |
| PF04075 | F420H2_quin_red | 1.72 |
| PF13683 | rve_3 | 1.72 |
| PF01548 | DEDD_Tnp_IS110 | 0.86 |
| PF13565 | HTH_32 | 0.86 |
| PF13701 | DDE_Tnp_1_4 | 0.86 |
| PF00872 | Transposase_mut | 0.86 |
| PF00378 | ECH_1 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 84.48 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.79 % |
| Unclassified | root | N/A | 11.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN01DY88E | Not Available | 510 | Open in IMG/M |
| 3300000956|JGI10216J12902_103338479 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300001162|JGI12714J13572_1005361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300001867|JGI12627J18819_10240760 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004080|Ga0062385_11283495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300004082|Ga0062384_100763441 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004479|Ga0062595_100566182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L-2-11 | 875 | Open in IMG/M |
| 3300005093|Ga0062594_101406304 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005468|Ga0070707_101257166 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005546|Ga0070696_101213563 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005553|Ga0066695_10862341 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005557|Ga0066704_10693051 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005564|Ga0070664_100143035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 2107 | Open in IMG/M |
| 3300005598|Ga0066706_10264054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1344 | Open in IMG/M |
| 3300005614|Ga0068856_100823225 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005764|Ga0066903_100952272 | Not Available | 1562 | Open in IMG/M |
| 3300006163|Ga0070715_10106554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1 | 1316 | Open in IMG/M |
| 3300006172|Ga0075018_10616208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300006606|Ga0074062_10025322 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300006871|Ga0075434_101447655 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300007265|Ga0099794_10568222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300009038|Ga0099829_11312572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300009038|Ga0099829_11686041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 521 | Open in IMG/M |
| 3300009089|Ga0099828_10113284 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2361 | Open in IMG/M |
| 3300009551|Ga0105238_10451140 | Not Available | 1283 | Open in IMG/M |
| 3300010048|Ga0126373_11040638 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300010398|Ga0126383_10442597 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1347 | Open in IMG/M |
| 3300011269|Ga0137392_10248378 | Not Available | 1464 | Open in IMG/M |
| 3300012096|Ga0137389_11434270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300012096|Ga0137389_11502331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300012203|Ga0137399_11752588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300012929|Ga0137404_10491996 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012944|Ga0137410_10419109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1082 | Open in IMG/M |
| 3300012957|Ga0164303_10992467 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012984|Ga0164309_11245922 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012988|Ga0164306_11920398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300016270|Ga0182036_10870869 | Not Available | 737 | Open in IMG/M |
| 3300016294|Ga0182041_12334837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 501 | Open in IMG/M |
| 3300016357|Ga0182032_10652501 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300016371|Ga0182034_11759766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300016371|Ga0182034_11989028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 514 | Open in IMG/M |
| 3300016404|Ga0182037_12108108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → Acidocella aminolytica | 507 | Open in IMG/M |
| 3300016422|Ga0182039_10133481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1894 | Open in IMG/M |
| 3300016422|Ga0182039_10635523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. IMCC20628 | 936 | Open in IMG/M |
| 3300016422|Ga0182039_11038500 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300016445|Ga0182038_11625167 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018060|Ga0187765_10146985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1327 | Open in IMG/M |
| 3300018422|Ga0190265_12332849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300018476|Ga0190274_10987661 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300019878|Ga0193715_1053353 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300020199|Ga0179592_10487256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 529 | Open in IMG/M |
| 3300021170|Ga0210400_10280890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1 | 1364 | Open in IMG/M |
| 3300021388|Ga0213875_10565167 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300021401|Ga0210393_10252286 | Not Available | 1431 | Open in IMG/M |
| 3300021432|Ga0210384_11302068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300021474|Ga0210390_11106623 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025922|Ga0207646_10757894 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300026078|Ga0207702_11016044 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300026324|Ga0209470_1182930 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300026557|Ga0179587_10922772 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027512|Ga0209179_1087740 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027521|Ga0209524_1041744 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300027521|Ga0209524_1051707 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027565|Ga0209219_1130104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300027812|Ga0209656_10095693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300027855|Ga0209693_10616311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300027889|Ga0209380_10516049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300027915|Ga0209069_10457135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300030494|Ga0310037_10255503 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031057|Ga0170834_108693140 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031545|Ga0318541_10277830 | Not Available | 932 | Open in IMG/M |
| 3300031561|Ga0318528_10672377 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031572|Ga0318515_10133080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1319 | Open in IMG/M |
| 3300031668|Ga0318542_10403067 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300031681|Ga0318572_10365705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → unclassified Sinorhizobium → Sinorhizobium sp. CCBAU 05631 | 856 | Open in IMG/M |
| 3300031719|Ga0306917_10193707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LSJC280B00 | 1535 | Open in IMG/M |
| 3300031744|Ga0306918_11437247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300031765|Ga0318554_10480509 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031768|Ga0318509_10553310 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031780|Ga0318508_1177192 | Not Available | 609 | Open in IMG/M |
| 3300031782|Ga0318552_10024266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2723 | Open in IMG/M |
| 3300031798|Ga0318523_10032851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2363 | Open in IMG/M |
| 3300031798|Ga0318523_10109776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
| 3300031799|Ga0318565_10030833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2423 | Open in IMG/M |
| 3300031821|Ga0318567_10876144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300031831|Ga0318564_10045559 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300031833|Ga0310917_10296218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1093 | Open in IMG/M |
| 3300031835|Ga0318517_10426950 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031880|Ga0318544_10019641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2254 | Open in IMG/M |
| 3300031890|Ga0306925_10349359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. IMCC20628 | 1588 | Open in IMG/M |
| 3300031890|Ga0306925_10786583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
| 3300031896|Ga0318551_10676978 | Not Available | 597 | Open in IMG/M |
| 3300031910|Ga0306923_12223076 | Not Available | 549 | Open in IMG/M |
| 3300031912|Ga0306921_11080567 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031939|Ga0308174_11312749 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031942|Ga0310916_10042545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3426 | Open in IMG/M |
| 3300031946|Ga0310910_10300875 | Not Available | 1262 | Open in IMG/M |
| 3300031946|Ga0310910_10375951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300031946|Ga0310910_11201953 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031954|Ga0306926_12106079 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300032001|Ga0306922_12311562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300032025|Ga0318507_10052424 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300032041|Ga0318549_10374199 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300032054|Ga0318570_10047545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1769 | Open in IMG/M |
| 3300032060|Ga0318505_10234166 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300032063|Ga0318504_10089210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1366 | Open in IMG/M |
| 3300032065|Ga0318513_10531841 | Not Available | 575 | Open in IMG/M |
| 3300032065|Ga0318513_10635359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300032066|Ga0318514_10565688 | Not Available | 605 | Open in IMG/M |
| 3300032067|Ga0318524_10182927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300032180|Ga0307471_103483099 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032782|Ga0335082_10456080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300032783|Ga0335079_10769907 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300033289|Ga0310914_10165921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1957 | Open in IMG/M |
| 3300033289|Ga0310914_10318610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. IMCC20628 | 1403 | Open in IMG/M |
| 3300033290|Ga0318519_10436412 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_07136430 | 2170459013 | Grass Soil | VIASKGGAGEPFDTLLPGKAGGAAAVRRTLETTICRIADPTLVASLACYLERRT |
| JGI10216J12902_1033384792 | 3300000956 | Soil | VITSQGGASEPPDTLLLGKAGGAVAVRRTLASTICRVAD |
| JGI12714J13572_10053612 | 3300001162 | Forest Soil | MIAAEGGASEPPNIGLPGKAGGVVAVRRTLASTICRIADPTQVPRPRQLRD |
| JGI12627J18819_102407601 | 3300001867 | Forest Soil | MIAAKGGASEPPNIGLPGKAGGAVAVRRTLACTICRIADPTQVPRPRQLRDVST |
| Ga0062385_112834951 | 3300004080 | Bog Forest Soil | MITSKGGASEPSNMLHPGKAGGAVAVRRALASTICRIADPTQVSRPRQ |
| Ga0062384_1007634411 | 3300004082 | Bog Forest Soil | MIASTAGGANDPSDTLLAGKAGGAVAVRRTLASTICRIADPTQV |
| Ga0062595_1005661822 | 3300004479 | Soil | VIASKGGASEPSNTLRPGKAGGTVAVRRTLASTIRRITDPTQVARPRQLRD |
| Ga0062594_1014063041 | 3300005093 | Soil | VIASKGGASETLNTLFTGKAGGTVTVRRTLASTICRIVDPTQVPRLR |
| Ga0070707_1012571661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VIASKGGASEPPNTLQLGKAGGAAAVRRTLDTTICRIADPTLVARPRQLRDAST |
| Ga0070696_1012135632 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VIASEGGASEPSETLLPGKAGGAVAVRRTLASTICRIADPT |
| Ga0066695_108623411 | 3300005553 | Soil | VTASKGGASEPPNTLLLGKAGGAAAVRRTLDTTICRVADPMHF* |
| Ga0066704_106930512 | 3300005557 | Soil | VIASEGGAREPPDTLLPGKVGGAAAVRRTLANTICRIADP |
| Ga0070664_1001430354 | 3300005564 | Corn Rhizosphere | MILIKGGAGEPYDLQLPGKAGGAVAVRRTLASTICR |
| Ga0066706_102640542 | 3300005598 | Soil | MIAFKGGAGEPSDMRLPGKAGGAVAVRRTLASTICR |
| Ga0068856_1008232252 | 3300005614 | Corn Rhizosphere | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRIADPM |
| Ga0066903_1009522723 | 3300005764 | Tropical Forest Soil | MITRKGGASEPFDMLPPGKAGGAAAVRRTLAHTICRI |
| Ga0070715_101065541 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAATGGASEPPNIGLPGKAGGAVAVRRTLASTICRIADPTQV |
| Ga0075018_106162081 | 3300006172 | Watersheds | MIAAKGGASEPFNMRLPGKAGGAVAVRRTLASTIC |
| Ga0074062_100253221 | 3300006606 | Soil | MIAAKGGASEPLNLGLPGKAGGAAAVRRTLDTTICRIADP |
| Ga0075434_1014476552 | 3300006871 | Populus Rhizosphere | VIASKGGASEPFDMLMPGKAGGAAAARRTLDTTICRI |
| Ga0099794_105682221 | 3300007265 | Vadose Zone Soil | MSAAKGGASEPPNMRLPGKAGGTVAVRRTLASTICRI |
| Ga0099829_113125721 | 3300009038 | Vadose Zone Soil | VITSKGGASEPSDTLLPGKAGGTVAVRRTLASTICRVADLTQV |
| Ga0099829_116860411 | 3300009038 | Vadose Zone Soil | MILFKGGAGEPSDMRLPGKAGGAVAVRRTLASTICRITDPTQV |
| Ga0099828_101132841 | 3300009089 | Vadose Zone Soil | VITSKGGANEPSDTLLPGKAGGTVAVRRTLASTICRVADLTQVAR |
| Ga0105238_104511402 | 3300009551 | Corn Rhizosphere | MILIKGGAGEPYNLQLPGKAGGAVAVRRTLASTICRIADPTQVPR |
| Ga0126373_110406381 | 3300010048 | Tropical Forest Soil | VSVSKGGASETPDTLLLGKAGGAVAVRRTLASTICRVADPTQVPRPRQL |
| Ga0126383_104425973 | 3300010398 | Tropical Forest Soil | MIRSKGGASEPFDMRLPGKAGDAVAVRRTLASTICRIADPTQVPRPRQLRDA |
| Ga0137392_102483783 | 3300011269 | Vadose Zone Soil | MILFKGGAGEPSDVRLPGKAGGAVAVRRTLAFTICRII |
| Ga0137389_114342702 | 3300012096 | Vadose Zone Soil | VITSKGGASEPSDTLLPGKAGGTVAVRRTLASTICRVADLTQVARL |
| Ga0137389_115023311 | 3300012096 | Vadose Zone Soil | KGGASEPSDTLLPGKAGGTVAVRRTLASTICRVAPI* |
| Ga0137399_117525882 | 3300012203 | Vadose Zone Soil | VIASRGGASEPSDTLLPGKAGGTVAIRRTLASTICRVADLTQVARLR |
| Ga0137404_104919962 | 3300012929 | Vadose Zone Soil | VIAAKGGASEPPDTLLLGKAGGAAAVRRTLDTTICRIADPMLVARPR* |
| Ga0137410_104191091 | 3300012944 | Vadose Zone Soil | MIAAKGGASEPLNLGLPGKAGGAVAVRRTLASTICRIAVPTLVA |
| Ga0164303_109924671 | 3300012957 | Soil | VIASEGGASEPPNTLLPGKAGGAAAVRRTLANTICRIADPMLVARPRQLRDASPVM |
| Ga0164309_112459221 | 3300012984 | Soil | MILIKGGAGEPYDLQLPGKAGGAVAVRRTLASTICRIADPTQVP |
| Ga0164306_119203982 | 3300012988 | Soil | VIASKGCASEPFDTLLPGKAGGAAAARRTLDTTICRISDPMLVARP |
| Ga0182036_108708691 | 3300016270 | Soil | VIARKGGASKPSDTLLPGKAGGAVTVRRTLATTICRMF |
| Ga0182041_123348372 | 3300016294 | Soil | VIVLQGGASEPSVTLLLGKAGGAAAVRRTLATTICRVDDPT |
| Ga0182032_106525012 | 3300016357 | Soil | MIASKGGASEPADMLQLGKPGGTAAVRRTLASTICRAIGPTQGC |
| Ga0182034_117597661 | 3300016371 | Soil | MIASKGGASEPADMLQLGKPGGTAAVRRTLASTICRAIGPTQVARL |
| Ga0182034_119890281 | 3300016371 | Soil | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRI |
| Ga0182037_121081081 | 3300016404 | Soil | MTAKGGASEPTDMLPPGTAGGAVAVRRTLASTIRWIADPTLVPRPRQLRDASTVMR |
| Ga0182039_101334813 | 3300016422 | Soil | MTAKGGASKPTDMLPPGSAGGAVAVRRTLASTICR |
| Ga0182039_106355231 | 3300016422 | Soil | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRISDPM |
| Ga0182039_110385001 | 3300016422 | Soil | VIASQGGASESPDTLLLGKAGGVVAVRRTLASTICR |
| Ga0182038_116251671 | 3300016445 | Soil | MTAKGGASKPTDMLPPGTAGGAVAVRRTLASTICRVTDPTQVPRPRH |
| Ga0187765_101469851 | 3300018060 | Tropical Peatland | MIASKGGASEPADTLRLGKAGGTAAVRRTLASTICRAIGPMLVA |
| Ga0190265_123328491 | 3300018422 | Soil | VVAVKGGASKPSDMLLPGKAGGAVAVRRTLASTICRIAD |
| Ga0190274_109876611 | 3300018476 | Soil | VITSKGGANEPSDTLRPGKAGGTVAVRRTLASTICRIIDPTQ |
| Ga0193715_10533532 | 3300019878 | Soil | VIVPRGGASEPSNTLLPGKAGGTVAVRRTLASTICRIADPTQVGNSATH |
| Ga0179592_104872562 | 3300020199 | Vadose Zone Soil | MILFKGGASEPYDMRLPDKAGGAVAVRRTLASTICRIADPTQVPR |
| Ga0210400_102808901 | 3300021170 | Soil | VIPFTGGASEPSNMLLPGKAGGTVAVRRTLACTICRIVDPTQV |
| Ga0213875_105651671 | 3300021388 | Plant Roots | MIRPRGGASEPSNMRLPGKAGGAVAVRRTLASTICRVTDP |
| Ga0210393_102522861 | 3300021401 | Soil | MIASKGGASEPADTLLLGKAGGAAAVRRTLASTICRAIGPMLVARPRQLRDA |
| Ga0210384_113020682 | 3300021432 | Soil | VTTSKGGASEPSNTLLPGKAGGTVAVRRTLASTIRRIADPTQVPR |
| Ga0210390_111066231 | 3300021474 | Soil | MIAFKGGADKPSDMLLPGKAGRAVTVRRILASTIC |
| Ga0207646_107578942 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIASKGGASEPPNTLQLGKAGGAAAVRRILDTTIC |
| Ga0207702_110160441 | 3300026078 | Corn Rhizosphere | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRIADPMLV |
| Ga0209470_11829301 | 3300026324 | Soil | MIAFKGGAGEPSDMRLPGKAGGAVAVRRTLASTICWITGPT |
| Ga0179587_109227722 | 3300026557 | Vadose Zone Soil | MIAFKGGASEPSDTLLPGKAGGAVAVRRTLASTICRIIDPTLAS |
| Ga0209179_10877402 | 3300027512 | Vadose Zone Soil | VIASKGGASEPSDTLLPGKAGGAVAVRRTLASTICRIIDPTLASR |
| Ga0209524_10417441 | 3300027521 | Forest Soil | VIPFTGGASEPSNMLLPGKAGGTVAVRRTLACTICRIVDPTQVARPR |
| Ga0209524_10517071 | 3300027521 | Forest Soil | VIASKGGASEPPDTLLPGKAGGAVAVRRTLATTICRIADP |
| Ga0209219_11301041 | 3300027565 | Forest Soil | VIASKGGASEPSDTLSPGKAGGTVAVRKTLASTIRRIADPTQVA |
| Ga0209656_100956931 | 3300027812 | Bog Forest Soil | VITGKGGAGKTSHRRLPGSAGGTAAVRRTLATTICRIADP |
| Ga0209693_106163111 | 3300027855 | Soil | VIASKGGASEPSDTLSPGKAGGTVAVRRTLASTIRRIADPTQVARPRQLRDVSTV |
| Ga0209380_105160491 | 3300027889 | Soil | VIASKGGANEPSDTLLPGKAGGTVAVRRTLASTICRIADPTQ |
| Ga0209069_104571351 | 3300027915 | Watersheds | VIASKGGASEPSNTLSPGKAGGTVAVRRTLASTIRRIADPTQVTR |
| Ga0310037_102555031 | 3300030494 | Peatlands Soil | MIAATAGGASEPTDTLLPGKAGGAVAVRRTLASTICRIADPMQVARPRQLRD |
| Ga0170834_1086931401 | 3300031057 | Forest Soil | VIASKGGASEPPNTLLPGKAGGAAAVRRTLASTICRIADPTL |
| Ga0318541_102778302 | 3300031545 | Soil | MSTAKGGASQPPNMRLPGKAGGAVAVRRTLASTIC |
| Ga0318528_106723772 | 3300031561 | Soil | VIASKGGASEPSDTLLPGKAGSAVAVRRTLASTICRVAD |
| Ga0318515_101330803 | 3300031572 | Soil | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRISDPL |
| Ga0318542_104030671 | 3300031668 | Soil | MIASKGGASEPADTLRLGKAGGTAAVRRTLASTIRRATGPTQVAR |
| Ga0318572_103657051 | 3300031681 | Soil | MTAKGGASKPTDMLPPGTAGGAVAVRRTLASTIRWIGDPTL |
| Ga0306917_101937072 | 3300031719 | Soil | ERNLPVIASQGGASEPPDMLPPGRAGGAVAVRRTLASTICQVADPTQVP |
| Ga0306918_114372471 | 3300031744 | Soil | VVASKGGASKPSNTFFASRAGGTVAVRRTLATTICRVADPTQVSRPRQLRDA |
| Ga0318554_104805092 | 3300031765 | Soil | VSVSKGGASESPDTLLLGKAGGAVAVRRTLASTICRVAD |
| Ga0318509_105533102 | 3300031768 | Soil | MAAKGGASEPTDTLPPGNAGGAVAVRRTLASTICRVADPMLVARPRQLRDAST |
| Ga0318508_11771921 | 3300031780 | Soil | MTAKGGASKPTDMLPPGSAGGAVAVRRTLASTICRIAD |
| Ga0318552_100242666 | 3300031782 | Soil | MAAKGGASEPTDTLPPGSAGGAVAVRRTLASTICRVADPL |
| Ga0318523_100328511 | 3300031798 | Soil | MAAKGGASEPTDTLPPGSAGGAVAVRRTLASTICRVADPLRTYG |
| Ga0318523_101097761 | 3300031798 | Soil | MIASKGGASEPADTLRLGKAGGTAAVRRTLASTIRRATGLA |
| Ga0318565_100308333 | 3300031799 | Soil | MTAKGGASKPTDMLPPGTAGGAVAVRRTLASTICRVTDPTQVPRPRHLR |
| Ga0318567_108761441 | 3300031821 | Soil | MIPSKGGASEPSDMRLLGKAGGAVAVRRTLACTICRVIADPTQVPRPRQ |
| Ga0318564_100455591 | 3300031831 | Soil | MILAKGGASEPPNIGLPGKAGGAVAVRRTLASTICRMTIPTQ |
| Ga0310917_102962181 | 3300031833 | Soil | VSVSKGGASETPDTLLLGKAGGAVAVRRTLASTICRVADPTQVPRPRQLRDA |
| Ga0318517_104269502 | 3300031835 | Soil | VSVSKGGASETPDTLLLGKAGGAVAVRRTLASTICRVADPTQVPR |
| Ga0318544_100196411 | 3300031880 | Soil | MAAKGGASEPTDTLPPGSAGGAVAVRRTLASTICRVADPTL |
| Ga0306925_103493593 | 3300031890 | Soil | VIASKGGASAPFDMLLPGKAGGAAAVRRTLETTICRISDPML |
| Ga0306925_107865833 | 3300031890 | Soil | VSVSKGGASESPDTLLLGKAGGAVAVRRTLASTICRVADPTQVP |
| Ga0318551_106769782 | 3300031896 | Soil | MTAKGGASKPTDMLPPGTAGGAVAVRRTLASTICRVTDPTQVPR |
| Ga0306923_122230761 | 3300031910 | Soil | MTAKGGASEPTDMLPPGTAGGAVAVRRTLASTIRWIADPTLVPRPRQLRDAS |
| Ga0306921_110805673 | 3300031912 | Soil | VSVSKGGASESPDTLLLGKAGGAVAVRRTLASTIC |
| Ga0308174_113127492 | 3300031939 | Soil | MIAFKGGASEPSDTLLPGKAGGAVAVRRTLASTICRIIDPTLASRPRQLRDAS |
| Ga0310916_100425455 | 3300031942 | Soil | MIASKGGASEPADMLQLGKPGGTAAVRRTLASTICRAIGPT |
| Ga0310910_103008752 | 3300031946 | Soil | VIAAKGGASERANMLLLGKAGGAAAARRTLASTICRAI |
| Ga0310910_103759513 | 3300031946 | Soil | VSVSKGGASETPDTLLLGKAGGAVAVRRTLASTIC |
| Ga0310910_112019532 | 3300031946 | Soil | VSVSKGGASESPDMLLLGKAGGAVAVRRTLASTICRVADPTQVPRPRQL |
| Ga0306926_121060791 | 3300031954 | Soil | VIASKGGASEPPDTLRPGKAGGAVAVRRTLATTICRVADPTQVARPRKLRD |
| Ga0306922_123115622 | 3300032001 | Soil | MIASKGGASEPADMLQLGKPGGTAAVRRTLASTICRAIGPTQVARLRQLRDASTV |
| Ga0318507_100524244 | 3300032025 | Soil | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRISDPMLVAR |
| Ga0318549_103741992 | 3300032041 | Soil | VSASQGGASKPPDMLLPGKAGGAVAVSRTLASTICRVTDPTQVPRPRQLRDAS |
| Ga0318570_100475451 | 3300032054 | Soil | VITSKGGASEPSDTLLPGRAGGAVAVRRTLASTICRIADP |
| Ga0318505_102341661 | 3300032060 | Soil | VSVSKGGASESPDTLLLGKAGGAVAVRRTLASTICRVADPTQVPRPRQLRDA |
| Ga0318504_100892101 | 3300032063 | Soil | MVASQGDAIESPNTLLPDKAGGAVAVRRTLATTICRITDPTLVARPRQLHD |
| Ga0318513_105318411 | 3300032065 | Soil | VIASKGGASEPRDMLLPGKAGGTAAVRRTLVSTICRVADPTLVARP |
| Ga0318513_106353591 | 3300032065 | Soil | VSVSKGGASETPDTLLLGKAGGAVAVRRTLASTICRVADPTQVPRPRQLRDASTV |
| Ga0318514_105656881 | 3300032066 | Soil | MTAKGGASKPTDMLPPGSAGGAVAVRRTLASTICRIADPTQVPRPR |
| Ga0318524_101829271 | 3300032067 | Soil | VITSKGGASEPSDTLLPGRAGGAVAVRRTLASTICRIADPTQEPR |
| Ga0307471_1034830992 | 3300032180 | Hardwood Forest Soil | MIPSRGGASEPSDMRLPGKAGGTVAVRRTLACTICRVTADPTQ |
| Ga0335082_104560801 | 3300032782 | Soil | VIPFTGGASEPSDTLFPGKAGGTVAVRRTLACTICRIIDPTQVPRPRQL |
| Ga0335079_107699071 | 3300032783 | Soil | VIASQGGASEPPGTLLLGKAGGAAAVRRTLDTTICRIADPTLVARPRQLRDVST |
| Ga0310914_101659211 | 3300033289 | Soil | MVASQGDAIESPNTLLPDKAGGAVAVRRTLATTICRITDPTLVARPRQL |
| Ga0310914_103186101 | 3300033289 | Soil | VIASKGGASEPFDMLLPGKAGGAAAVRRTLETTICRISDPMLVARPRQLRDAT |
| Ga0318519_104364122 | 3300033290 | Soil | VIASQGGASEPPDMLPPGKAGGAVAVRRTLATTICRVADPTQVPR |
| ⦗Top⦘ |