


| Basic Information | |
|---|---|
| Family ID | F079176 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MMNSGPVRDGAAQAASAASEAPLLKLEDFLPHRLNVLSSLVSQ |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.41 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.38 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.621 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.517 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF01406 | tRNA-synt_1e | 19.83 |
| PF09190 | DALR_2 | 4.31 |
| PF13176 | TPR_7 | 0.86 |
| PF13673 | Acetyltransf_10 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 24.14 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 19.83 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 19.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.62 % |
| Unclassified | root | N/A | 16.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig82546 | Not Available | 516 | Open in IMG/M |
| 3300000956|JGI10216J12902_103249031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300004049|Ga0055493_10109520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300004479|Ga0062595_100459043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 939 | Open in IMG/M |
| 3300005178|Ga0066688_10562607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300005181|Ga0066678_10716088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300005340|Ga0070689_100035697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3799 | Open in IMG/M |
| 3300005560|Ga0066670_10015088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3440 | Open in IMG/M |
| 3300005713|Ga0066905_101084012 | Not Available | 710 | Open in IMG/M |
| 3300005713|Ga0066905_101316873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300005764|Ga0066903_108471388 | Not Available | 524 | Open in IMG/M |
| 3300005841|Ga0068863_101530154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300005983|Ga0081540_1094457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300006046|Ga0066652_100029499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3908 | Open in IMG/M |
| 3300006046|Ga0066652_101092367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300006172|Ga0075018_10007393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3979 | Open in IMG/M |
| 3300006604|Ga0074060_10001602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 622 | Open in IMG/M |
| 3300006880|Ga0075429_101729882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 543 | Open in IMG/M |
| 3300006894|Ga0079215_10820446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300006953|Ga0074063_10102735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300007076|Ga0075435_101140284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300009088|Ga0099830_10579749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300009100|Ga0075418_12520138 | Not Available | 561 | Open in IMG/M |
| 3300009792|Ga0126374_11156252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300010046|Ga0126384_10168766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1703 | Open in IMG/M |
| 3300010046|Ga0126384_10730170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300010048|Ga0126373_12236524 | Not Available | 608 | Open in IMG/M |
| 3300010326|Ga0134065_10335487 | Not Available | 589 | Open in IMG/M |
| 3300010360|Ga0126372_12134811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300010361|Ga0126378_10769289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1073 | Open in IMG/M |
| 3300010361|Ga0126378_12708995 | Not Available | 566 | Open in IMG/M |
| 3300010362|Ga0126377_12352993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300010366|Ga0126379_11957539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300010366|Ga0126379_12252676 | Not Available | 645 | Open in IMG/M |
| 3300010371|Ga0134125_12126032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
| 3300010373|Ga0134128_10703531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
| 3300010375|Ga0105239_10965895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 979 | Open in IMG/M |
| 3300010398|Ga0126383_11618707 | Not Available | 737 | Open in IMG/M |
| 3300010398|Ga0126383_13059614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300010398|Ga0126383_13301016 | Not Available | 527 | Open in IMG/M |
| 3300010399|Ga0134127_10682848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
| 3300010401|Ga0134121_10852632 | Not Available | 880 | Open in IMG/M |
| 3300010868|Ga0124844_1135356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300011271|Ga0137393_11417285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300012208|Ga0137376_10281641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1443 | Open in IMG/M |
| 3300012208|Ga0137376_10754167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300012212|Ga0150985_121238530 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012351|Ga0137386_10475376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300012358|Ga0137368_10457672 | Not Available | 828 | Open in IMG/M |
| 3300012359|Ga0137385_10406964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1159 | Open in IMG/M |
| 3300012362|Ga0137361_10134444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2193 | Open in IMG/M |
| 3300012469|Ga0150984_111398489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300012683|Ga0137398_10081413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1998 | Open in IMG/M |
| 3300012924|Ga0137413_10912293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300012930|Ga0137407_10730656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300012958|Ga0164299_10272696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300012971|Ga0126369_10627910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1147 | Open in IMG/M |
| 3300012988|Ga0164306_10179618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1469 | Open in IMG/M |
| 3300014307|Ga0075304_1114213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300014501|Ga0182024_10674499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1280 | Open in IMG/M |
| 3300016270|Ga0182036_10188251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1503 | Open in IMG/M |
| 3300016270|Ga0182036_10593931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300016422|Ga0182039_11101207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300016445|Ga0182038_12092761 | Not Available | 513 | Open in IMG/M |
| 3300017792|Ga0163161_11108039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300017792|Ga0163161_11363845 | Not Available | 618 | Open in IMG/M |
| 3300018066|Ga0184617_1085347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 862 | Open in IMG/M |
| 3300018422|Ga0190265_12887794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300018431|Ga0066655_10324291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300018469|Ga0190270_12061748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300019876|Ga0193703_1002336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2740 | Open in IMG/M |
| 3300019881|Ga0193707_1200579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300021363|Ga0193699_10435867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300021510|Ga0222621_1002923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2765 | Open in IMG/M |
| 3300025321|Ga0207656_10114348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1250 | Open in IMG/M |
| 3300025910|Ga0207684_11417866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300025912|Ga0207707_11219264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300025916|Ga0207663_10242135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1323 | Open in IMG/M |
| 3300025929|Ga0207664_10781713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300025942|Ga0207689_10378572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1178 | Open in IMG/M |
| 3300026041|Ga0207639_10209422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1677 | Open in IMG/M |
| 3300026332|Ga0209803_1310025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300027576|Ga0209003_1044343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 782 | Open in IMG/M |
| 3300027655|Ga0209388_1004189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3627 | Open in IMG/M |
| 3300028713|Ga0307303_10011450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1589 | Open in IMG/M |
| 3300028810|Ga0307294_10071317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300028814|Ga0307302_10226821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
| 3300028814|Ga0307302_10279641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300028814|Ga0307302_10640104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300028819|Ga0307296_10101282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1543 | Open in IMG/M |
| 3300028876|Ga0307286_10029810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1795 | Open in IMG/M |
| 3300028878|Ga0307278_10458971 | Not Available | 558 | Open in IMG/M |
| 3300029636|Ga0222749_10454023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 687 | Open in IMG/M |
| 3300031198|Ga0307500_10015591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1593 | Open in IMG/M |
| 3300031198|Ga0307500_10078459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 851 | Open in IMG/M |
| 3300031199|Ga0307495_10247248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031545|Ga0318541_10231204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300031564|Ga0318573_10087097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1586 | Open in IMG/M |
| 3300031573|Ga0310915_10142517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1652 | Open in IMG/M |
| 3300031719|Ga0306917_11510577 | Not Available | 517 | Open in IMG/M |
| 3300031768|Ga0318509_10127040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1394 | Open in IMG/M |
| 3300031793|Ga0318548_10265562 | Not Available | 843 | Open in IMG/M |
| 3300031845|Ga0318511_10526572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300031847|Ga0310907_10879325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031858|Ga0310892_10933388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300031879|Ga0306919_10608873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300031880|Ga0318544_10064712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
| 3300031894|Ga0318522_10367174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300031912|Ga0306921_12235560 | Not Available | 575 | Open in IMG/M |
| 3300032044|Ga0318558_10034450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2158 | Open in IMG/M |
| 3300032060|Ga0318505_10529182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300032089|Ga0318525_10717641 | Not Available | 508 | Open in IMG/M |
| 3300032163|Ga0315281_10704524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300032180|Ga0307471_100069625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3027 | Open in IMG/M |
| 3300032261|Ga0306920_101365604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1017 | Open in IMG/M |
| 3300033290|Ga0318519_10090256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.86% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.86% | |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01772250 | 2124908016 | MTNSGPVRDNAALVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALTRV | |
| JGI10216J12902_1032490311 | 3300000956 | Soil | MMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNV |
| Ga0055493_101095201 | 3300004049 | Natural And Restored Wetlands | MSTVNSGAVRENAQSTPAASPAGLLKLDDFLPHRLNVLSSLVSQALTSVYGRYG |
| Ga0062595_1004590433 | 3300004479 | Soil | MMNSGPIRDGAAHADLAQDDVPRDEAAPAKLSLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| Ga0066688_105626071 | 3300005178 | Soil | MMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSL |
| Ga0066678_107160882 | 3300005181 | Soil | MMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| Ga0070689_1000356971 | 3300005340 | Switchgrass Rhizosphere | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQALTRVYGR |
| Ga0066670_100150886 | 3300005560 | Soil | MNSGPLRDNAAHAASAASEAPLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| Ga0066905_1010840121 | 3300005713 | Tropical Forest Soil | LMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNV |
| Ga0066905_1013168731 | 3300005713 | Tropical Forest Soil | MMNSGPVRDGAAQAAASAGPAEAALLKLEDFLPHRLNVLSSLVSQALTRV |
| Ga0066903_1084713882 | 3300005764 | Tropical Forest Soil | LMMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVS |
| Ga0068863_1015301542 | 3300005841 | Switchgrass Rhizosphere | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQA |
| Ga0081540_10944571 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMNSGPVRDSAAHSAAAPADAPLLKLEDFLPHRLN |
| Ga0066652_1000294996 | 3300006046 | Soil | MTNSGPVRDNAAHVDAAQAEAPLLKLEDFLPHRLNVLSSLV |
| Ga0066652_1010923671 | 3300006046 | Soil | MMNSGPIRDGAVHADLAQDDAPRDEAAPAKLSLLKLEDFLPHRLNVLSSL |
| Ga0075018_100073936 | 3300006172 | Watersheds | MMNSGPVQDGAAKVAEPDETALLKLEDFLPHKLNVLSSLVSQALTRV |
| Ga0074060_100016021 | 3300006604 | Soil | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSS |
| Ga0075429_1017298822 | 3300006880 | Populus Rhizosphere | VSSGCGVEAMANSVPVREGAPAGAPLLKLEEFLPHRLNVLSSLVSLALTR |
| Ga0079215_108204461 | 3300006894 | Agricultural Soil | MSSGAVREKATQSASAGGDAPLLKLDDFLPHRLNVLSSLV |
| Ga0074063_101027351 | 3300006953 | Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNV |
| Ga0075435_1011402842 | 3300007076 | Populus Rhizosphere | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSL |
| Ga0099830_105797491 | 3300009088 | Vadose Zone Soil | MTNADPVHDATATAAPAEAPLLKLEDFLPHRLNVLSSLV |
| Ga0075418_125201381 | 3300009100 | Populus Rhizosphere | MTNSGPVRDNAAHVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALT |
| Ga0126374_111562521 | 3300009792 | Tropical Forest Soil | MMNSGPVRDGATHAASAPDQTGAPAPLLKLEDFLPHRLNVLSSLVSQALTR |
| Ga0126384_101687663 | 3300010046 | Tropical Forest Soil | MTNADPIHDDAVTGAPAAAAPTPVLKLEDFLPHRLNVLSSLVSQALTRVYGR |
| Ga0126384_107301701 | 3300010046 | Tropical Forest Soil | LMTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVL |
| Ga0126373_122365241 | 3300010048 | Tropical Forest Soil | MTNSGPVHEGASKVAASAEPLLKLEDFLPHKLNVLSSL |
| Ga0134065_103354871 | 3300010326 | Grasslands Soil | MNSGPLRDNAAHAASAASEAPLLKLEDFLPHRLNVLSS |
| Ga0126372_121348111 | 3300010360 | Tropical Forest Soil | MNSGPVRDNAAHAAAAPSEAPLLKLEDFLPHRLNVLSSLVSQALTRV |
| Ga0126378_107692891 | 3300010361 | Tropical Forest Soil | MTNADPIHDGDALSAPAPAAPVPMLKLEDFLPHRLNVLSSLVSQALTR |
| Ga0126378_127089951 | 3300010361 | Tropical Forest Soil | MTNSGPVRDNAAHVDAAQGEAPLLKLEDFLPHRLNVLSSLVSQALTRVYGRHG |
| Ga0126377_123529931 | 3300010362 | Tropical Forest Soil | MMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVY |
| Ga0126379_119575392 | 3300010366 | Tropical Forest Soil | MMNSGPARDGAAEAAAPEPLLKLEDFLPHRLNVLSSLVSQ |
| Ga0126379_122526761 | 3300010366 | Tropical Forest Soil | MMNSGPVRDGAAQAALAASEAPLLKLEDFLPHRLNV |
| Ga0134125_121260322 | 3300010371 | Terrestrial Soil | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGR |
| Ga0134128_107035312 | 3300010373 | Terrestrial Soil | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQALT |
| Ga0105239_109658951 | 3300010375 | Corn Rhizosphere | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRHG |
| Ga0126383_116187071 | 3300010398 | Tropical Forest Soil | MMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLSSL |
| Ga0126383_130596141 | 3300010398 | Tropical Forest Soil | MMNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSS |
| Ga0126383_133010161 | 3300010398 | Tropical Forest Soil | MMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNV |
| Ga0134127_106828481 | 3300010399 | Terrestrial Soil | MNSGPVRENTAPAGLALSEAPVLRLEEFLPHRLNVLSSLVSQDLTRRYGRY |
| Ga0134121_108526321 | 3300010401 | Terrestrial Soil | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTR |
| Ga0124844_11353561 | 3300010868 | Tropical Forest Soil | MNSGPVRDNAAQAATAPSEAPLLKLEDFLPHRLNVLSSL |
| Ga0137393_114172851 | 3300011271 | Vadose Zone Soil | MIKSGSHRDAAALDASPPAQAPLLKLEHFLPHRLNVLSSLISQALTGVYGR |
| Ga0137376_102816413 | 3300012208 | Vadose Zone Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLS |
| Ga0137376_107541671 | 3300012208 | Vadose Zone Soil | MTNSGPVRDNAAHIDAAQPETPLLKLDDFLPHRLNVLSSLVSQALTRV |
| Ga0150985_1212385301 | 3300012212 | Avena Fatua Rhizosphere | MSNPNPVPDTDVDGANAPILKLEDFLPHRLNVLSSLVSQALT |
| Ga0137386_104753761 | 3300012351 | Vadose Zone Soil | MNPGPLRDNAAHAASAPSEAPLLKLEDFLPHRLNVLSSLVSQALTR |
| Ga0137368_104576722 | 3300012358 | Vadose Zone Soil | MSSGPVRDNAAHAAPPEAPLLKLEDFLPHRLNVLSS |
| Ga0137385_104069641 | 3300012359 | Vadose Zone Soil | MINSGPVQESAANAEKAAESALLKLEDFLPHRLNVLSSL |
| Ga0137361_101344441 | 3300012362 | Vadose Zone Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLN |
| Ga0150984_1113984892 | 3300012469 | Avena Fatua Rhizosphere | MNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSS |
| Ga0137398_100814133 | 3300012683 | Vadose Zone Soil | MMNSGPVHDGAAKVAVPGEPALLRLEDFLPHKLNVLSS |
| Ga0137413_109122932 | 3300012924 | Vadose Zone Soil | MMSSGPAREGAAQAAAATSEAPLLKLEDFLPHRLNVLSSLVSQAL |
| Ga0137407_107306562 | 3300012930 | Vadose Zone Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVSQALTRV |
| Ga0164299_102726961 | 3300012958 | Soil | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVS |
| Ga0126369_106279101 | 3300012971 | Tropical Forest Soil | MMNSGPARDGAAEAAAPEPLLKLEDFLPHRLNVLSSLVSQA |
| Ga0164306_101796183 | 3300012988 | Soil | MNSGPVRENTSPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRV |
| Ga0075304_11142132 | 3300014307 | Natural And Restored Wetlands | MSTVNSGAVRENAQSTPAASPAGLLKLDDFLPHRLNVLS |
| Ga0182024_106744993 | 3300014501 | Permafrost | MMNSGPVQDGATQVAAPSETILLKLEDFLPHRLNVLSSLVSQALARVYGQ |
| Ga0182036_101882514 | 3300016270 | Soil | MRQPGPDNMTNSGPVHDGASKVAASAEPLLKLEDFLPHKLNVLSSLVSQALSRVYGE |
| Ga0182036_105939312 | 3300016270 | Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVL |
| Ga0182039_111012071 | 3300016422 | Soil | MTNSGPVRDSAARAASAGEDLAPTKSALLKLEDFLPHRLNVLSSLVSQALTRV |
| Ga0182038_120927611 | 3300016445 | Soil | LMMNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHR |
| Ga0163161_111080391 | 3300017792 | Switchgrass Rhizosphere | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSS |
| Ga0163161_113638452 | 3300017792 | Switchgrass Rhizosphere | MTNSGPVRDNAAHVDAACAEAPLLKLEDFLPHRLNVLSSLVSQALTRV |
| Ga0184617_10853471 | 3300018066 | Groundwater Sediment | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTR |
| Ga0190265_128877942 | 3300018422 | Soil | LIMSSGAVREKATQSASAGGDAPLLKLDDFLPHRLNVLSSLVS |
| Ga0066655_103242911 | 3300018431 | Grasslands Soil | MTNSGPVRDNAAHVDAAQAEAPLLKLEDFLPHRLNVLSSLVSQALTRVY |
| Ga0190270_120617481 | 3300018469 | Soil | MNSGPVRENTASAGSAPSEAPLLRLEEYLPHRLNDL |
| Ga0193703_10023361 | 3300019876 | Soil | MNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYGI |
| Ga0193707_12005791 | 3300019881 | Soil | MMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRYG |
| Ga0193699_104358672 | 3300021363 | Soil | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLLSQAL |
| Ga0222621_10029234 | 3300021510 | Groundwater Sediment | MMNSGPVRDSAQPAGTAPSEAPLLRLDDFLPHRLNVLSSLVSQALTRV |
| Ga0207656_101143483 | 3300025321 | Corn Rhizosphere | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVL |
| Ga0207684_114178661 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSGPVRDNAAHTAAAPPEAPLLKLEDFLPHRLNVLSSLVSQALTRVYGRYG |
| Ga0207707_112192642 | 3300025912 | Corn Rhizosphere | MNSGPVRENTAPAGSAPSEAPLLRLEDFLPHRLNVLSSLVSQALTR |
| Ga0207663_102421353 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSGPVRENTAPAGSAPSEAPLLRLEDFLPHRLNVL |
| Ga0207664_107817132 | 3300025929 | Agricultural Soil | MMNSRPVHDGTAKLAVPSETALLRLEDFLPHRLNVLSSLVSQALTRVYGRR |
| Ga0207689_103785723 | 3300025942 | Miscanthus Rhizosphere | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLVSQA |
| Ga0207639_102094223 | 3300026041 | Corn Rhizosphere | MNSGPVRENTAPAGLAPSEAPVLRLEEFLPHRLNVLSSLV |
| Ga0209803_13100251 | 3300026332 | Soil | MMNSGPVRDGAAQAASTASDAPLLKLEDFLPHRLNVLSSLVSQA |
| Ga0209003_10443431 | 3300027576 | Forest Soil | MMNSGPVRDGAAQAASAASDGPLLKLEDFLPHRLNVLSSL |
| Ga0209388_10041896 | 3300027655 | Vadose Zone Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLV |
| Ga0307303_100114503 | 3300028713 | Soil | MMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNV |
| Ga0307294_100713171 | 3300028810 | Soil | MNSGPVRENTAPAGSAPPEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYG |
| Ga0307302_102268211 | 3300028814 | Soil | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRV |
| Ga0307302_102796411 | 3300028814 | Soil | MMNSGPVRDSTAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVS |
| Ga0307302_106401042 | 3300028814 | Soil | MMNSGPVRDSAAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQALTRV |
| Ga0307296_101012823 | 3300028819 | Soil | MMNSGPVRDSTAPAGTAPSEAPLLRLDEFLPHRLNVLSSLVSQAL |
| Ga0307286_100298103 | 3300028876 | Soil | MNSGPVRENTAPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYG |
| Ga0307278_104589711 | 3300028878 | Soil | MSSGPVLDNAAHAAAPPEAPLLKLEDFLPHRLNVLSS |
| Ga0222749_104540232 | 3300029636 | Soil | MMNSGPVQDGAAAVAQPGETALLKLEDFLPHKLNVLSSLVSQALNRV |
| Ga0307500_100155911 | 3300031198 | Soil | MNSGPLRENTPAGSAPSEAPLLRLEEFLPHRLNVLSSLVSQALTRVYGRYG |
| Ga0307500_100784592 | 3300031198 | Soil | MSSNQVRDSAAQAASTPAQAGSQAGSQAGLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| Ga0307495_102472482 | 3300031199 | Soil | MMNSGPVRDSAPPAGTAPSEAPLLRLDEFLPHRLNVLSSLV |
| Ga0318541_102312042 | 3300031545 | Soil | MNSGPVRDNAAQAAATPSEAPLLKLEDFLPHRLNVLSRLV |
| Ga0318573_100870973 | 3300031564 | Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVSQALT |
| Ga0310915_101425173 | 3300031573 | Soil | MTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPH |
| Ga0306917_115105771 | 3300031719 | Soil | LMTNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLSSL |
| Ga0318509_101270402 | 3300031768 | Soil | MTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLN |
| Ga0318548_102655622 | 3300031793 | Soil | MTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| Ga0318511_105265721 | 3300031845 | Soil | MNSGPVRDNAAQAAATPSEAPLLKLEDFLPHRLNVLSSLVSHALTRVYGRRYGIG |
| Ga0310907_108793252 | 3300031847 | Soil | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLS |
| Ga0310892_109333882 | 3300031858 | Soil | MMNSGPVRDGTAPVASASSGAPLLRLDEFLPHRLNVLSSLVSQALTRVYGRHGIG |
| Ga0306919_106088731 | 3300031879 | Soil | MTNSGPFRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQA |
| Ga0318544_100647121 | 3300031880 | Soil | MTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQA |
| Ga0318522_103671742 | 3300031894 | Soil | MMNSGPVRDGAAQAASAASEAPLLKLEDFLPHRLNVLSSLVSQ |
| Ga0306921_122355601 | 3300031912 | Soil | LMTNSGPVRDGATHAASAPDQTGAQAPLLKLDDFLPHRLNVLS |
| Ga0318558_100344503 | 3300032044 | Soil | MTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRL |
| Ga0318505_105291821 | 3300032060 | Soil | MMNSGPVRDGAAQAASAASDAPLLKLEDFLPHRLNVLSSLVS |
| Ga0318525_107176411 | 3300032089 | Soil | MTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSS |
| Ga0315281_107045242 | 3300032163 | Sediment | MINSGPASRDAAAQSAPDLKLEDFLPHRLNVLSSLVSQALTHVYGHH |
| Ga0307471_1000696255 | 3300032180 | Hardwood Forest Soil | LNGPRDTPARVTMNSGPVRDNAAHAVAAPSEAPLLKLEDFLPHRLNVLSSLV |
| Ga0306920_1013656041 | 3300032261 | Soil | MRNSGPLHEGLAKAHSPAETALLKLEDFLPHRLNVLSSLVSHAL |
| Ga0318519_100902563 | 3300033290 | Soil | MTNSGPVRDGATHAASAPDQTGAQAPLLKLEDFLPHRLNVLSSLVSQALTRVYG |
| ⦗Top⦘ |