


| Basic Information | |
|---|---|
| Family ID | F079175 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.93 % |
| % of genes near scaffold ends (potentially truncated) | 21.55 % |
| % of genes from short scaffolds (< 2000 bps) | 78.45 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (51.724 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.724 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.63% β-sheet: 0.00% Coil/Unstructured: 72.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00717 | Peptidase_S24 | 15.52 |
| PF01039 | Carboxyl_trans | 6.03 |
| PF00005 | ABC_tran | 5.17 |
| PF07750 | GcrA | 3.45 |
| PF12399 | BCA_ABC_TP_C | 2.59 |
| PF02785 | Biotin_carb_C | 1.72 |
| PF02604 | PhdYeFM_antitox | 0.86 |
| PF13738 | Pyr_redox_3 | 0.86 |
| PF02653 | BPD_transp_2 | 0.86 |
| PF10116 | Host_attach | 0.86 |
| PF06114 | Peptidase_M78 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 6.03 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 6.03 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 6.03 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 3.45 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.86 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.38 % |
| Unclassified | root | N/A | 8.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig25254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1307 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig68979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1434 | Open in IMG/M |
| 3300000908|JGI11915J12861_104733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300005994|Ga0066789_10291009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300005995|Ga0066790_10529862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300006041|Ga0075023_100063383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1193 | Open in IMG/M |
| 3300006047|Ga0075024_100286565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 803 | Open in IMG/M |
| 3300006050|Ga0075028_100175692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1145 | Open in IMG/M |
| 3300006050|Ga0075028_100176986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1140 | Open in IMG/M |
| 3300006050|Ga0075028_100469181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 730 | Open in IMG/M |
| 3300006057|Ga0075026_100182246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1095 | Open in IMG/M |
| 3300006172|Ga0075018_10007620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3921 | Open in IMG/M |
| 3300007255|Ga0099791_10334752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 724 | Open in IMG/M |
| 3300007255|Ga0099791_10400211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300007258|Ga0099793_10106521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1301 | Open in IMG/M |
| 3300007258|Ga0099793_10255314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300007265|Ga0099794_10031377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2487 | Open in IMG/M |
| 3300007265|Ga0099794_10212591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 992 | Open in IMG/M |
| 3300009038|Ga0099829_10022494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4351 | Open in IMG/M |
| 3300009088|Ga0099830_10472677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1020 | Open in IMG/M |
| 3300009089|Ga0099828_10255960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1571 | Open in IMG/M |
| 3300009090|Ga0099827_10443381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1112 | Open in IMG/M |
| 3300009143|Ga0099792_10031453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2461 | Open in IMG/M |
| 3300009143|Ga0099792_10034154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2379 | Open in IMG/M |
| 3300010877|Ga0126356_11060048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3926 | Open in IMG/M |
| 3300011269|Ga0137392_10053793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3038 | Open in IMG/M |
| 3300011444|Ga0137463_1198544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 752 | Open in IMG/M |
| 3300012096|Ga0137389_10507509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300012189|Ga0137388_10224564 | Not Available | 1701 | Open in IMG/M |
| 3300012189|Ga0137388_10641709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300012189|Ga0137388_11302262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300012198|Ga0137364_10000280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 19376 | Open in IMG/M |
| 3300012198|Ga0137364_10241734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1332 | Open in IMG/M |
| 3300012200|Ga0137382_10388219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis | 983 | Open in IMG/M |
| 3300012201|Ga0137365_10236872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1360 | Open in IMG/M |
| 3300012202|Ga0137363_11578512 | Not Available | 548 | Open in IMG/M |
| 3300012203|Ga0137399_10036929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 3431 | Open in IMG/M |
| 3300012205|Ga0137362_10020235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5111 | Open in IMG/M |
| 3300012207|Ga0137381_10197302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1743 | Open in IMG/M |
| 3300012209|Ga0137379_10053814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 3873 | Open in IMG/M |
| 3300012209|Ga0137379_11487533 | Not Available | 578 | Open in IMG/M |
| 3300012210|Ga0137378_10550554 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300012211|Ga0137377_10000882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 19749 | Open in IMG/M |
| 3300012351|Ga0137386_10156377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1631 | Open in IMG/M |
| 3300012351|Ga0137386_10269331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1225 | Open in IMG/M |
| 3300012359|Ga0137385_10307682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1363 | Open in IMG/M |
| 3300012359|Ga0137385_11452231 | Not Available | 549 | Open in IMG/M |
| 3300012362|Ga0137361_10263436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1572 | Open in IMG/M |
| 3300012582|Ga0137358_10238025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1240 | Open in IMG/M |
| 3300012683|Ga0137398_10080231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2011 | Open in IMG/M |
| 3300012685|Ga0137397_10024652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4257 | Open in IMG/M |
| 3300012685|Ga0137397_10212441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1440 | Open in IMG/M |
| 3300012918|Ga0137396_10164710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1620 | Open in IMG/M |
| 3300012922|Ga0137394_10017985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5627 | Open in IMG/M |
| 3300012929|Ga0137404_10240888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1549 | Open in IMG/M |
| 3300012929|Ga0137404_10348690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1295 | Open in IMG/M |
| 3300012930|Ga0137407_10509925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1124 | Open in IMG/M |
| 3300012930|Ga0137407_12019642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300012944|Ga0137410_11934280 | Not Available | 523 | Open in IMG/M |
| 3300015264|Ga0137403_10575745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 992 | Open in IMG/M |
| 3300018027|Ga0184605_10108983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1226 | Open in IMG/M |
| 3300018028|Ga0184608_10025511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2186 | Open in IMG/M |
| 3300018051|Ga0184620_10073307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300018066|Ga0184617_1124408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300018071|Ga0184618_10312574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300018075|Ga0184632_10199665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 880 | Open in IMG/M |
| 3300018075|Ga0184632_10331872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300018075|Ga0184632_10347493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300018081|Ga0184625_10293244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 850 | Open in IMG/M |
| 3300019789|Ga0137408_1223192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1826 | Open in IMG/M |
| 3300019789|Ga0137408_1291847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1723 | Open in IMG/M |
| 3300019866|Ga0193756_1046930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300019867|Ga0193704_1049593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
| 3300019872|Ga0193754_1022556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300019874|Ga0193744_1002863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3167 | Open in IMG/M |
| 3300019875|Ga0193701_1107105 | Not Available | 514 | Open in IMG/M |
| 3300019881|Ga0193707_1080729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 997 | Open in IMG/M |
| 3300019886|Ga0193727_1003476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6562 | Open in IMG/M |
| 3300020004|Ga0193755_1117661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 830 | Open in IMG/M |
| 3300020170|Ga0179594_10289062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300021073|Ga0210378_10309520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300021080|Ga0210382_10043847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1736 | Open in IMG/M |
| 3300024288|Ga0179589_10205112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300026304|Ga0209240_1110452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
| 3300026475|Ga0257147_1073840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300026508|Ga0257161_1118057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300026551|Ga0209648_10541232 | Not Available | 654 | Open in IMG/M |
| 3300027181|Ga0208997_1016634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1018 | Open in IMG/M |
| 3300027381|Ga0208983_1019748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1315 | Open in IMG/M |
| 3300027388|Ga0208995_1046486 | Not Available | 764 | Open in IMG/M |
| 3300027512|Ga0209179_1040176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 983 | Open in IMG/M |
| 3300027633|Ga0208988_1154542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300027643|Ga0209076_1187756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300027671|Ga0209588_1005869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3538 | Open in IMG/M |
| 3300027671|Ga0209588_1015924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2316 | Open in IMG/M |
| 3300027738|Ga0208989_10009041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3392 | Open in IMG/M |
| 3300027846|Ga0209180_10131349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1438 | Open in IMG/M |
| 3300027862|Ga0209701_10478838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 680 | Open in IMG/M |
| 3300027862|Ga0209701_10730915 | Not Available | 506 | Open in IMG/M |
| 3300027894|Ga0209068_10661226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300027910|Ga0209583_10047207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
| 3300028536|Ga0137415_10069067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3397 | Open in IMG/M |
| 3300028536|Ga0137415_10091686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2895 | Open in IMG/M |
| 3300028536|Ga0137415_10685574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300028792|Ga0307504_10030114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
| 3300028793|Ga0307299_10225015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 705 | Open in IMG/M |
| 3300028814|Ga0307302_10154538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
| 3300028824|Ga0307310_10259961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 836 | Open in IMG/M |
| 3300028828|Ga0307312_10685885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 678 | Open in IMG/M |
| 3300028828|Ga0307312_10822888 | Not Available | 615 | Open in IMG/M |
| 3300028881|Ga0307277_10365391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300029987|Ga0311334_10262393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1339 | Open in IMG/M |
| 3300031507|Ga0307509_10446660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 988 | Open in IMG/M |
| 3300031616|Ga0307508_10078015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2892 | Open in IMG/M |
| 3300033180|Ga0307510_10090253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2912 | Open in IMG/M |
| 3300033180|Ga0307510_10355798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 51.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.17% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 3.45% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.86% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.86% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000908 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00229000 | 2124908043 | Soil | MMDMRPGLVRRAHQTERLTPSPIILPAEAIAVTLLILVVALGLTIR |
| A5_c1_01841550 | 2124908044 | Soil | MDLQPGPGRRSHRAESPTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| JGI11915J12861_1047331 | 3300000908 | Forest Soil | MDMRPGLVRRARQAERLTPSSIIPRAEAIAVTLLILVVALGVMIRSG |
| Ga0066789_102910093 | 3300005994 | Soil | MNMRPGLVRRAHQTERLTPSPIILPAEAIAVTLLILVVALGLTIRS |
| Ga0066790_105298621 | 3300005995 | Soil | MRPGLVRRAHQTERLTPSPIILPTEAIAVTLLILVVALGLTIRS |
| Ga0075023_1000633833 | 3300006041 | Watersheds | MDVHSGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA* |
| Ga0075024_1002865652 | 3300006047 | Watersheds | MDIRPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA* |
| Ga0075028_1001756923 | 3300006050 | Watersheds | MDAHPEPVRRAHRAEPLTPSPIILPVEAIAVMLLILVLALGLMIRSGT* |
| Ga0075028_1001769864 | 3300006050 | Watersheds | RAEPLTPSPIILPVEAIAVMLLILVLALGLMIRSGA* |
| Ga0075028_1004691813 | 3300006050 | Watersheds | GTVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA* |
| Ga0075026_1001822463 | 3300006057 | Watersheds | MDIRPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGK* |
| Ga0075018_100076203 | 3300006172 | Watersheds | MDVHPGTVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA* |
| Ga0099791_103347521 | 3300007255 | Vadose Zone Soil | MDLQPGPVRRSHRAEPLTPSPIILSAEAIAVMFLILVRALGLTIRSGE* |
| Ga0099791_104002112 | 3300007255 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLTLGLMIRSGT* |
| Ga0099793_101065212 | 3300007258 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAITVMLLILVLALGLMVRSGT* |
| Ga0099793_102553142 | 3300007258 | Vadose Zone Soil | MEVRPGPVRRSHRAEPLTPSPIILPAEAMVVMLLIFILALGLLIRNGA* |
| Ga0099794_100313772 | 3300007265 | Vadose Zone Soil | MDLQPGPVRRSHRAKPLTPSPIILPAEAIAMMLLIFVLALGLMVRSGA* |
| Ga0099794_102125912 | 3300007265 | Vadose Zone Soil | MDVQSGLVRRSPRVEPLTPSPVILPAEAIAVTLLIFVLVLGVLIRIGL* |
| Ga0099829_100224945 | 3300009038 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT* |
| Ga0099830_104726772 | 3300009088 | Vadose Zone Soil | MDVHRRLVRGLHRAEPLTPSPIILPAEAIAVTLLIFILALGVMLRGGA* |
| Ga0099828_102559602 | 3300009089 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRRGT* |
| Ga0099827_104433812 | 3300009090 | Vadose Zone Soil | MDVHPGPVRGAHRAEPLTPSPIILPAEAVAVMLLILVLALGLMVRSGT* |
| Ga0099792_100314532 | 3300009143 | Vadose Zone Soil | MDVQPGPVRRSHRAEPLTPSSSPLILPAEALVVALLIFVLALGLMVRSGT* |
| Ga0099792_100341543 | 3300009143 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMFLILVLALGLMIRSGT* |
| Ga0126356_110600481 | 3300010877 | Boreal Forest Soil | MDLQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLIIVLALGLTIRSGT* |
| Ga0137392_100537933 | 3300011269 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMVRSGT* |
| Ga0137463_11985441 | 3300011444 | Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLI |
| Ga0137389_105075093 | 3300012096 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT* |
| Ga0137388_102245642 | 3300012189 | Vadose Zone Soil | MDLQPGPVRRSHRAEPLTPSPIILPAEAIAMMLLIFVLALGLMVRSGA* |
| Ga0137388_106417092 | 3300012189 | Vadose Zone Soil | MDAHPEPVRRAHRAEPLTPSPIILPVEAIAVMLLILVLALGLMIRSGK* |
| Ga0137388_113022622 | 3300012189 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRRGT* |
| Ga0137364_100002802 | 3300012198 | Vadose Zone Soil | MDAQRGFVRSTRRAKPLTPSPVILPAEALAVMLLIVVVTLGLMTRSGA* |
| Ga0137364_102417343 | 3300012198 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSST* |
| Ga0137382_103882192 | 3300012200 | Vadose Zone Soil | MGVQPGPVRRSHRAEHLTPSPITLPAEAVAVMLLILVLALGLMIRSGS* |
| Ga0137365_102368724 | 3300012201 | Vadose Zone Soil | MDMQPGSVRSSHRAAPQAPAPIILPAEAIAVTLLIIVLALGVMIGSSA* |
| Ga0137363_115785122 | 3300012202 | Vadose Zone Soil | MDVHPGPVRGAHRAEPLTPCPIILPAEAIAVMLLILVLTLGLMIRSGT* |
| Ga0137399_100369291 | 3300012203 | Vadose Zone Soil | MDMRPGLVRRAHQIERLTPSPIIPPAEAIAVTLLILVVALGLTIRS* |
| Ga0137362_100202353 | 3300012205 | Vadose Zone Soil | MDPGPVRGAHRAEPLTTSPIILPAEAIAVMLLILVLTLGLMIRSGT* |
| Ga0137381_101973024 | 3300012207 | Vadose Zone Soil | SVRRSHRAAPQAPFPIILPAEAIAVTLLIIMLALGVMIRSST* |
| Ga0137379_100538148 | 3300012209 | Vadose Zone Soil | MGGQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSDT* |
| Ga0137379_114875332 | 3300012209 | Vadose Zone Soil | MDMQPGSVRSSHRAAPQAPFPIILPAEAIAVTLLIIVLALGVMIRSSA* |
| Ga0137378_105505541 | 3300012210 | Vadose Zone Soil | RAAPQAPAPIILPAEAIAVTLLIIVLALGVMIGSSA* |
| Ga0137377_1000088223 | 3300012211 | Vadose Zone Soil | MDAQRGLVRSTRRAKPLTPSPVILPAEALAVMLLIVVVTLGLMTRSGA* |
| Ga0137386_101563773 | 3300012351 | Vadose Zone Soil | MDMQPGSVRRSHRAAPQAPFPIILPAEAIAVTLLIIMLALGVMIRSSA* |
| Ga0137386_102693312 | 3300012351 | Vadose Zone Soil | MGGQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSST* |
| Ga0137385_103076823 | 3300012359 | Vadose Zone Soil | MGVHPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMVRSGT* |
| Ga0137385_114522312 | 3300012359 | Vadose Zone Soil | RAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT* |
| Ga0137361_102634363 | 3300012362 | Vadose Zone Soil | MDPGPVRGAHRAEPLTPCPIILPAEAIAVMLLILVLTLGLMIRSGT* |
| Ga0137358_102380252 | 3300012582 | Vadose Zone Soil | MEVRPGPVRRSHRAEPLTPSPIILPAEAMVVMLLVFILALGLLIRNGA* |
| Ga0137398_100802312 | 3300012683 | Vadose Zone Soil | MDMRPGLVRRAHQIERLTPSPIIPPAEAIAVTLLILVVARLA* |
| Ga0137397_100246522 | 3300012685 | Vadose Zone Soil | MDAQSGLVRRSPRVTPSPIILPAEAIAVTLLIFVLALGVMIRSGA* |
| Ga0137397_102124414 | 3300012685 | Vadose Zone Soil | EPLTPSPIILPAEAIAVMLLIIVLALGLTIRSGT* |
| Ga0137396_101647102 | 3300012918 | Vadose Zone Soil | MDVQSGLVRRSPRVEPLTPSPIILPAEAIAVTLLIFVLALGVMIRSGA* |
| Ga0137394_100179856 | 3300012922 | Vadose Zone Soil | MDAQSGLVRRSPRVEPLTPSPIILPAEAIAVTLLIFVLALGVMIRSGA* |
| Ga0137404_102408883 | 3300012929 | Vadose Zone Soil | MDLQPGPVRRSHRAEPLTPSPIILPAEAIAMMLLIFVLALGLMVRSGT* |
| Ga0137404_103486902 | 3300012929 | Vadose Zone Soil | MGVQSGPVRRSHRAEPLTLSPIILPAEAVAVMLLILVLALGLMIRSGT* |
| Ga0137407_105099252 | 3300012930 | Vadose Zone Soil | MGVQSGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT* |
| Ga0137407_120196421 | 3300012930 | Vadose Zone Soil | MGVQPGPVRRSHRAELLTPSPIILPAEAVAVMLLILVLALGLMIRSGT* |
| Ga0137410_119342802 | 3300012944 | Vadose Zone Soil | MDMQSGLIRRSHRAEPPTPFPIILPAEAIAVALLIVILVLGLMIRSGA* |
| Ga0137403_105757452 | 3300015264 | Vadose Zone Soil | MDLQPGPVRRSHRAEPLTPSPIILPAEAITMMLLIFVLALGLMVRSGT* |
| Ga0184605_101089832 | 3300018027 | Groundwater Sediment | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMFLILVLALGLMIRSGT |
| Ga0184608_100255111 | 3300018028 | Groundwater Sediment | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMVRNGT |
| Ga0184620_100733073 | 3300018051 | Groundwater Sediment | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0184617_11244083 | 3300018066 | Groundwater Sediment | MDLHPGPVRGAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0184618_103125742 | 3300018071 | Groundwater Sediment | RSHRAEPLTPSPIILPAEAVAVMFLILVLALGLMIRSGT |
| Ga0184632_101996652 | 3300018075 | Groundwater Sediment | MDVQPGPVRRSHRAEPLTPSPIILPVEAIAVMLLILVLAFGLMIRGGA |
| Ga0184632_103318722 | 3300018075 | Groundwater Sediment | GPVRRSHRAEPLTPSPIILPVEAIAVMLLILVLALGLMVRSGT |
| Ga0184632_103474933 | 3300018075 | Groundwater Sediment | MDVQPGPVRRSHRAEPLTPSPIILPVEAIAVMLLILVLALGL |
| Ga0184625_102932442 | 3300018081 | Groundwater Sediment | MDVQPGPVRRSHRAESLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0137408_12231921 | 3300019789 | Vadose Zone Soil | MGVQSGPVRRSHRAEPLTLSPIILPAEAVAVMLLILVLALGLMIRSGT |
| Ga0137408_12918471 | 3300019789 | Vadose Zone Soil | MDLQPGPVRRSHRAEPLTPSPIILPAEAIAMMLLIFVLALGLMVRSGT |
| Ga0193756_10469302 | 3300019866 | Soil | RRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0193704_10495933 | 3300019867 | Soil | MNIRPGPVRRAHRAEPLTPSAIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0193754_10225561 | 3300019872 | Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLTLGLMIRSGT |
| Ga0193744_10028633 | 3300019874 | Soil | MDVQPGPVRRAHRAEPLTPSPIILPVEAIAVMLLILVLALGLMIRSGT |
| Ga0193701_11071052 | 3300019875 | Soil | DLHPGPVRGAHRAEPLTPSPIILPAEAVAVMLLILVLALGLMVRNGT |
| Ga0193707_10807291 | 3300019881 | Soil | MNIRPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0193727_10034762 | 3300019886 | Soil | MDVQPGPVRRAHRAEPLTPSPIILPVETIAVMLLILVLALGLMIRSGT |
| Ga0193755_11176612 | 3300020004 | Soil | MDVQSGLVRRSPRVEPLTPSPIILPAEAIAVTLLIFVLALGVMIRSGA |
| Ga0179594_102890621 | 3300020170 | Vadose Zone Soil | GPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT |
| Ga0210378_103095201 | 3300021073 | Groundwater Sediment | MNIRPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMVRNGT |
| Ga0210382_100438473 | 3300021080 | Groundwater Sediment | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0179589_102051122 | 3300024288 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVTLLIFVLALGVMIRSGA |
| Ga0209240_11104523 | 3300026304 | Grasslands Soil | MDAQSGLVRRSPRVEPLTPSPIILPAEAIAVTLLIFVLALGVMIRSGA |
| Ga0257147_10738401 | 3300026475 | Soil | MDMRPGLVRRAHQAERLTPSPIILPAEAIAVMLLI |
| Ga0257161_11180571 | 3300026508 | Soil | MDMRAGLGRAHQAERPTPSPIILPAEAIAVTLLILVVALGVMIRSGMTP |
| Ga0209648_105412321 | 3300026551 | Grasslands Soil | AEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT |
| Ga0208997_10166342 | 3300027181 | Forest Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMFLILVLALGLMIRSGT |
| Ga0208983_10197483 | 3300027381 | Forest Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAIAVMLLIIVLALGLTIRSGT |
| Ga0208995_10464862 | 3300027388 | Forest Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT |
| Ga0209179_10401762 | 3300027512 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAVAVMLLILVLALALMIRSGT |
| Ga0208988_11545422 | 3300027633 | Forest Soil | MEVRPGPVRRSHRAEPLTPSPIILPAEAMVVMLLIFILALGLLIRNGA |
| Ga0209076_11877561 | 3300027643 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAITVMLLILVL |
| Ga0209588_10058693 | 3300027671 | Vadose Zone Soil | MDLQPGPVRRSHRAKPLTPSPIILPAEAIAMMLLIFVLALGLMVRSGA |
| Ga0209588_10159242 | 3300027671 | Vadose Zone Soil | MDVHPGPVRRAHRAEPLTPSPIILPAEAITVMLLILVLALGLMVRSGT |
| Ga0208989_100090416 | 3300027738 | Forest Soil | MGVQPGPVRRSHLAEPLTPSPIILPAEAVAVMLLILVLALGLMIRSGT |
| Ga0209180_101313492 | 3300027846 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAVAVMLLILVLALGLMVRSGT |
| Ga0209701_104788381 | 3300027862 | Vadose Zone Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILV |
| Ga0209701_107309151 | 3300027862 | Vadose Zone Soil | RGLHRAEPLTPSPIILPAEAIAVTLLIFILALGVMLRGGA |
| Ga0209068_106612261 | 3300027894 | Watersheds | MDVHPGTVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA |
| Ga0209583_100472073 | 3300027910 | Watersheds | MDVHSGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGA |
| Ga0137415_100690676 | 3300028536 | Vadose Zone Soil | MDAQSGLVRRSPRVTPSPIILPAEAIAVTLLIFVLALGVMIRSGA |
| Ga0137415_100916864 | 3300028536 | Vadose Zone Soil | MDMRPGLVRRAHQIERLTPSPIIPPAEAIAVTLLILVVARLA |
| Ga0137415_106855743 | 3300028536 | Vadose Zone Soil | MDVQPGPVRRSHRAEPLTPSPSPIILPAEAMVVTLLIFVLALGLMIRSTA |
| Ga0307504_100301142 | 3300028792 | Soil | MDIRPGPVRRAHRTEPLTPSPIILPAEAIAVMLLILVLALGLMIRSGT |
| Ga0307299_102250152 | 3300028793 | Soil | MGVQPGPFRRSHRAEPLTPSPIILPAEAVAVMFLILVLALGLMIRSGT |
| Ga0307302_101545382 | 3300028814 | Soil | MGVQPGPVRRSHRAEPLTPSPIILPAEAIAVMLLILVLALGLMVRNGT |
| Ga0307310_102599613 | 3300028824 | Soil | MDVQPGPVRRAHRAEPLTPSPIILPAEAVAVMFLILVLALGLMIRSGT |
| Ga0307312_106858851 | 3300028828 | Soil | MNIRPGPVRRAHRAEPLTPSPIILPAEAIAVMLLILVLALVLMIRSGT |
| Ga0307312_108228882 | 3300028828 | Soil | MDVHPGPVRRAHRTEPLTPSPIILPAEAIAVMLLILVLALGLMVRNGT |
| Ga0307277_103653912 | 3300028881 | Soil | MGVQPGPVRRSHRAEPLTPTPIILPAEAVAVMFLILVLALGLMIRSGT |
| Ga0311334_102623933 | 3300029987 | Fen | MDVQPRLVRRPHQAEPLTPSPVILPAEAIAVTLLIFILALGVMIRSGA |
| Ga0307509_104466602 | 3300031507 | Ectomycorrhiza | MEVPPEPVHWSDCREPLTPYPIILPAEAMAVTLLILVLALGLMLRNGA |
| Ga0307508_100780153 | 3300031616 | Ectomycorrhiza | MDVRRGSVHRVHRAEPLMPSSIILAAEALAVTLLIFILVLGLMIRTGA |
| Ga0307510_100902534 | 3300033180 | Ectomycorrhiza | MEVPPEPVRWSDCREPLTPYPIILPAEAMAVTLLILVLALGLMLRNGA |
| Ga0307510_103557982 | 3300033180 | Ectomycorrhiza | MDIRPGPVRRAHRAEPLTPSPIILPAEAITVMLLILVLALGLMVRSGT |
| ⦗Top⦘ |