


| Basic Information | |
|---|---|
| Family ID | F079155 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRDPEIIETELMEISAIADDSIKLERIIAWCASHPDEVPF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 68.10 % |
| % of genes near scaffold ends (potentially truncated) | 93.10 % |
| % of genes from short scaffolds (< 2000 bps) | 90.52 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.897 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (9.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain | d1hn0a1 | 1hn0 | 0.74215 |
| a.24.15.0: automated matches | d3gwla1 | 3gwl | 0.71471 |
| a.253.1.1: AF0941-like | d1yoza1 | 1yoz | 0.70158 |
| d.64.2.1: TM1457-like | d2idla1 | 2idl | 0.69585 |
| c.56.5.4: Bacterial dinuclear zinc exopeptidases | d1cg2a1 | 1cg2 | 0.69235 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF06283 | ThuA | 4.31 |
| PF02687 | FtsX | 3.45 |
| PF01546 | Peptidase_M20 | 2.59 |
| PF12543 | DUF3738 | 2.59 |
| PF02543 | Carbam_trans_N | 2.59 |
| PF01436 | NHL | 1.72 |
| PF04226 | Transgly_assoc | 1.72 |
| PF01431 | Peptidase_M13 | 1.72 |
| PF00271 | Helicase_C | 1.72 |
| PF06532 | NrsF | 1.72 |
| PF13378 | MR_MLE_C | 1.72 |
| PF00756 | Esterase | 0.86 |
| PF01804 | Penicil_amidase | 0.86 |
| PF00873 | ACR_tran | 0.86 |
| PF02852 | Pyr_redox_dim | 0.86 |
| PF00581 | Rhodanese | 0.86 |
| PF03551 | PadR | 0.86 |
| PF01177 | Asp_Glu_race | 0.86 |
| PF02652 | Lactate_perm | 0.86 |
| PF01156 | IU_nuc_hydro | 0.86 |
| PF13620 | CarboxypepD_reg | 0.86 |
| PF00135 | COesterase | 0.86 |
| PF01165 | Ribosomal_S21 | 0.86 |
| PF01609 | DDE_Tnp_1 | 0.86 |
| PF00665 | rve | 0.86 |
| PF01828 | Peptidase_A4 | 0.86 |
| PF13360 | PQQ_2 | 0.86 |
| PF11154 | DUF2934 | 0.86 |
| PF01180 | DHO_dh | 0.86 |
| PF06974 | WS_DGAT_C | 0.86 |
| PF01566 | Nramp | 0.86 |
| PF08668 | HDOD | 0.86 |
| PF13420 | Acetyltransf_4 | 0.86 |
| PF04008 | Adenosine_kin | 0.86 |
| PF03328 | HpcH_HpaI | 0.86 |
| PF08448 | PAS_4 | 0.86 |
| PF07589 | PEP-CTERM | 0.86 |
| PF01022 | HTH_5 | 0.86 |
| PF02881 | SRP54_N | 0.86 |
| PF00753 | Lactamase_B | 0.86 |
| PF12704 | MacB_PCD | 0.86 |
| PF08241 | Methyltransf_11 | 0.86 |
| PF00771 | FHIPEP | 0.86 |
| PF01977 | UbiD | 0.86 |
| PF12697 | Abhydrolase_6 | 0.86 |
| PF03306 | AAL_decarboxy | 0.86 |
| PF10502 | Peptidase_S26 | 0.86 |
| PF13007 | LZ_Tnp_IS66 | 0.86 |
| PF13442 | Cytochrome_CBB3 | 0.86 |
| PF00326 | Peptidase_S9 | 0.86 |
| PF06439 | 3keto-disac_hyd | 0.86 |
| PF02515 | CoA_transf_3 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 4.31 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 2.59 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.72 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 1.72 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.86 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.86 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.86 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.86 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.86 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.86 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.86 |
| COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.86 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.86 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.86 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.86 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.86 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.86 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.86 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.86 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.86 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.86 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.86 |
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.86 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.86 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.86 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.62 % |
| Unclassified | root | N/A | 16.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_102704478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1267 | Open in IMG/M |
| 3300002568|C688J35102_118760460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 593 | Open in IMG/M |
| 3300004631|Ga0058899_11836654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 770 | Open in IMG/M |
| 3300005332|Ga0066388_106819462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300005367|Ga0070667_100882007 | Not Available | 832 | Open in IMG/M |
| 3300005435|Ga0070714_101085224 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005436|Ga0070713_101945631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300005531|Ga0070738_10287873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 694 | Open in IMG/M |
| 3300005534|Ga0070735_10586035 | Not Available | 662 | Open in IMG/M |
| 3300005541|Ga0070733_10660723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 701 | Open in IMG/M |
| 3300005840|Ga0068870_10677457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300006028|Ga0070717_11234100 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006028|Ga0070717_11463503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300006052|Ga0075029_100935965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300006162|Ga0075030_100148936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1894 | Open in IMG/M |
| 3300006172|Ga0075018_10558528 | Not Available | 604 | Open in IMG/M |
| 3300006237|Ga0097621_101091063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300006358|Ga0068871_102078520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 541 | Open in IMG/M |
| 3300006852|Ga0075433_11256371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 642 | Open in IMG/M |
| 3300009098|Ga0105245_10296069 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300009177|Ga0105248_10218534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 2146 | Open in IMG/M |
| 3300009177|Ga0105248_11406743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300009630|Ga0116114_1021460 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300009636|Ga0116112_1235706 | Not Available | 504 | Open in IMG/M |
| 3300009698|Ga0116216_10916301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 524 | Open in IMG/M |
| 3300009700|Ga0116217_10636224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 663 | Open in IMG/M |
| 3300010379|Ga0136449_100574696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1930 | Open in IMG/M |
| 3300011269|Ga0137392_10819593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300012210|Ga0137378_11091888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 712 | Open in IMG/M |
| 3300012359|Ga0137385_10164820 | Not Available | 1946 | Open in IMG/M |
| 3300012960|Ga0164301_11319384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 586 | Open in IMG/M |
| 3300012971|Ga0126369_10090977 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300013306|Ga0163162_12147979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 641 | Open in IMG/M |
| 3300014158|Ga0181521_10626060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 501 | Open in IMG/M |
| 3300014167|Ga0181528_10468848 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300014489|Ga0182018_10590229 | Not Available | 583 | Open in IMG/M |
| 3300014490|Ga0182010_10052092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1953 | Open in IMG/M |
| 3300014492|Ga0182013_10289360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300014493|Ga0182016_10228434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1180 | Open in IMG/M |
| 3300014494|Ga0182017_10304568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300014496|Ga0182011_10774953 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300014498|Ga0182019_10126287 | Not Available | 1596 | Open in IMG/M |
| 3300014499|Ga0182012_10910724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 554 | Open in IMG/M |
| 3300014502|Ga0182021_13411567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 529 | Open in IMG/M |
| 3300014838|Ga0182030_10455489 | Not Available | 1301 | Open in IMG/M |
| 3300014839|Ga0182027_10233646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2112 | Open in IMG/M |
| 3300014839|Ga0182027_10876214 | Not Available | 932 | Open in IMG/M |
| 3300014839|Ga0182027_10988244 | Not Available | 863 | Open in IMG/M |
| 3300015374|Ga0132255_104174290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 613 | Open in IMG/M |
| 3300016371|Ga0182034_10741654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 837 | Open in IMG/M |
| 3300017935|Ga0187848_10343846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 618 | Open in IMG/M |
| 3300017988|Ga0181520_10198894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1577 | Open in IMG/M |
| 3300017988|Ga0181520_10924559 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300018005|Ga0187878_1336769 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua → Candidatus Scalindua rubra | 535 | Open in IMG/M |
| 3300018008|Ga0187888_1278975 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300018019|Ga0187874_10361761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 587 | Open in IMG/M |
| 3300018026|Ga0187857_10101092 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Micrarchaeota → unclassified Candidatus Micrarchaeota → Candidatus Micrarchaeota archaeon | 1403 | Open in IMG/M |
| 3300018034|Ga0187863_10463637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300018083|Ga0184628_10147023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1226 | Open in IMG/M |
| 3300019787|Ga0182031_1283902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 1772 | Open in IMG/M |
| 3300019788|Ga0182028_1352796 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300019788|Ga0182028_1365491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 2357 | Open in IMG/M |
| 3300021171|Ga0210405_11173610 | Not Available | 570 | Open in IMG/M |
| 3300021377|Ga0213874_10420961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 523 | Open in IMG/M |
| 3300021478|Ga0210402_10924133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 799 | Open in IMG/M |
| 3300021559|Ga0210409_11525351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 544 | Open in IMG/M |
| 3300021560|Ga0126371_13390963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 538 | Open in IMG/M |
| 3300021861|Ga0213853_10417587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 517 | Open in IMG/M |
| 3300023088|Ga0224555_1199650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 549 | Open in IMG/M |
| 3300023091|Ga0224559_1077015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1268 | Open in IMG/M |
| 3300025147|Ga0209511_1156152 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300025473|Ga0208190_1044628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300025500|Ga0208686_1088503 | Not Available | 669 | Open in IMG/M |
| 3300025922|Ga0207646_11635980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300025927|Ga0207687_10308196 | Not Available | 1277 | Open in IMG/M |
| 3300025929|Ga0207664_11977156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300026035|Ga0207703_11205001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 728 | Open in IMG/M |
| 3300026088|Ga0207641_11042307 | Not Available | 815 | Open in IMG/M |
| 3300026281|Ga0209863_10008744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3263 | Open in IMG/M |
| 3300027854|Ga0209517_10684580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 530 | Open in IMG/M |
| 3300027867|Ga0209167_10042513 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300027911|Ga0209698_10215567 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300027986|Ga0209168_10146982 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300030041|Ga0302274_10316405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 720 | Open in IMG/M |
| 3300030580|Ga0311355_11760027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031236|Ga0302324_102314898 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031238|Ga0265332_10150189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 975 | Open in IMG/M |
| 3300031250|Ga0265331_10360391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 651 | Open in IMG/M |
| 3300031259|Ga0302187_10120597 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Micrarchaeota → unclassified Candidatus Micrarchaeota → Candidatus Micrarchaeota archaeon | 1463 | Open in IMG/M |
| 3300031708|Ga0310686_110918791 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031716|Ga0310813_11787066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 577 | Open in IMG/M |
| 3300031765|Ga0318554_10842452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 512 | Open in IMG/M |
| 3300031821|Ga0318567_10193362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1135 | Open in IMG/M |
| 3300031938|Ga0308175_101624424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300031938|Ga0308175_101756299 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031938|Ga0308175_102683901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300031939|Ga0308174_10188127 | Not Available | 1566 | Open in IMG/M |
| 3300031996|Ga0308176_10370802 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300032067|Ga0318524_10516629 | Not Available | 627 | Open in IMG/M |
| 3300032074|Ga0308173_10694746 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300032076|Ga0306924_10111029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 3110 | Open in IMG/M |
| 3300032180|Ga0307471_100073949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2958 | Open in IMG/M |
| 3300032770|Ga0335085_12021046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 584 | Open in IMG/M |
| 3300032782|Ga0335082_11567268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300032783|Ga0335079_10565258 | Not Available | 1204 | Open in IMG/M |
| 3300032805|Ga0335078_10159331 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
| 3300032805|Ga0335078_11736359 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300032895|Ga0335074_11077671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300032897|Ga0335071_11634004 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300032897|Ga0335071_12155645 | Not Available | 500 | Open in IMG/M |
| 3300032954|Ga0335083_10079929 | Not Available | 3300 | Open in IMG/M |
| 3300033158|Ga0335077_10053150 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300033402|Ga0326728_10391498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1194 | Open in IMG/M |
| 3300033513|Ga0316628_102258581 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300033891|Ga0334811_139611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 603 | Open in IMG/M |
| 3300034965|Ga0370497_0169754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.48% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 8.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.31% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 4.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.59% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.72% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.86% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.86% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.86% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300025147 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1027044782 | 3300001213 | Wetland | MRDPEIIETELMEISAIADDTLKFERIIAWCASHPDEVPFALHQL |
| C688J35102_1187604602 | 3300002568 | Soil | MRDPETIETELMEISAIADDTVKFERIIAWCATHPDEVPFA |
| Ga0058899_118366543 | 3300004631 | Forest Soil | MRDREIIETELMEISAIADDAVKFERIVAWCAARPDEVPFALHQLL |
| Ga0066388_1068194621 | 3300005332 | Tropical Forest Soil | VCHPGVSMRDAEIIETELMEISAIPEDAVKLERIIAWCATHPDEVPFAL |
| Ga0070667_1008820072 | 3300005367 | Switchgrass Rhizosphere | MRDPQVIEAELVEIGAISDDSLKLERIIAWCATYPDEVPFAIRLLLDR* |
| Ga0070714_1010852242 | 3300005435 | Agricultural Soil | MRDPETIETELMEISAIADDGVKLERIIAWCATHPDEVPFALHQ |
| Ga0070713_1019456311 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVFLMRDPETIETELMEISAIAEDTVKFERIVAWCVAHPDEIPFAL |
| Ga0070738_102878731 | 3300005531 | Surface Soil | MRDPETIETDLMDIAAIADEGVKLERIIAWCAVHPDEIP |
| Ga0070735_105860351 | 3300005534 | Surface Soil | MREPETIENELIEIGAIPDDLVKFERIVAWCAAHPDEVP |
| Ga0070733_106607231 | 3300005541 | Surface Soil | MCHARVSMRDPEIIETELMEIGAVADDAVKLERIIAWCASHPDEVPFA |
| Ga0068870_106774571 | 3300005840 | Miscanthus Rhizosphere | MLVCMRDPETIDTELMEISAITDDVLKLERIIAWCATHPDEVPFALHQF |
| Ga0070717_112341001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRDEQIVEAELMEISAIQDDTIKLERIVAWCANYPDEIPF |
| Ga0070717_114635032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDPETIETELMEISSIADDLVKFERIIAWCASHP |
| Ga0075029_1009359651 | 3300006052 | Watersheds | MRDLEIIETELMEISAIADDTIKLERIIAWCASHPDEVPFALHQL |
| Ga0075030_1001489363 | 3300006162 | Watersheds | MRDLDTVESELFEISAIPEDGLKLERIIAWCATHPDEVPMAIHLLLVRRNAETPKE* |
| Ga0075018_105585281 | 3300006172 | Watersheds | MRDLAVIEAELSEISAIQDDTLKLERIVAWSAAHPHEVPLALRFF |
| Ga0097621_1010910632 | 3300006237 | Miscanthus Rhizosphere | MWHASSMRDPAVIEAELIEISAIADDTLKLERIIAWCATHPDE |
| Ga0068871_1020785201 | 3300006358 | Miscanthus Rhizosphere | MRDPEVIEAELMEISGTADDTIKLERIIAWCASHPDEVP |
| Ga0075433_112563711 | 3300006852 | Populus Rhizosphere | MRDAEIIETELMEISAIADDTVKFERIIAWCATHPDE |
| Ga0105245_102960693 | 3300009098 | Miscanthus Rhizosphere | MRDLQVIEAELVEIGAISDDSLKLERIIAWCATYPDEVPFAIRLLLDR* |
| Ga0105248_102185343 | 3300009177 | Switchgrass Rhizosphere | MRDPEIIETELMEISAIPDDLVKLERIIAWCASHPDEV |
| Ga0105248_114067432 | 3300009177 | Switchgrass Rhizosphere | MLVCMRDPETIDTELMEISAITDDVLKLERIIAWCATHPD |
| Ga0116114_10214601 | 3300009630 | Peatland | MRAPEVIETELMEISAIAEDTDKLERTIAWCATHPDEVPFALHQLL |
| Ga0116112_12357062 | 3300009636 | Peatland | MRDPETIETELMEISAIAGDAVKLERIIAWCACHPDEVPF |
| Ga0116216_109163011 | 3300009698 | Peatlands Soil | MRDPEIIETELMEISAIADDTLKFERIIAWCASHPD |
| Ga0116217_106362241 | 3300009700 | Peatlands Soil | MRDSETIETELMEISAIADESIKLERIIAWCASHPDEVPFA |
| Ga0136449_1005746966 | 3300010379 | Peatlands Soil | MRDPEIIETELMEISAIADDTLKFERIIAWCASHPDEVPFALHQF |
| Ga0137392_108195932 | 3300011269 | Vadose Zone Soil | MRDPEIIENELMEISAIADDTIKLERIIAWCAAHPDEVPFALHHL |
| Ga0137378_110918881 | 3300012210 | Vadose Zone Soil | MRDPEIIEAELIEISAMADDTLKLERIIAWCASHPDEVPFALHQLR |
| Ga0137385_101648202 | 3300012359 | Vadose Zone Soil | MRDPEVIESELIEISAIADDTLKLERIIAWCASHPDEIPFA |
| Ga0164301_113193842 | 3300012960 | Soil | MRDPEIIETELMEISAIADDTVKFERIIAWCAAHPDE |
| Ga0126369_100909773 | 3300012971 | Tropical Forest Soil | MRDPAEIEKELMEISAIAEDGTKLEWIIAWCANHPDEVPFALKILMSRS* |
| Ga0163162_121479791 | 3300013306 | Switchgrass Rhizosphere | MRDPEVIEAELMEISGTADDTIKLERIIAWCASHPD |
| Ga0181521_106260601 | 3300014158 | Bog | MRDPETIETELMEISAIAEDTVKFERIVAWCATHPDEVPF |
| Ga0181528_104688483 | 3300014167 | Bog | MRDSEIIETELMEIGAIPDDALKLERIISWCAMHPEEVPFALHQLLG |
| Ga0182018_105902292 | 3300014489 | Palsa | MREPEQIEEELFEIAGMADDGTKLEQIIAWCATHPD |
| Ga0182010_100520921 | 3300014490 | Fen | MRDADIIETELTEISAIADDTLRFERIIVWCASNPDDVPFA |
| Ga0182013_102893601 | 3300014492 | Bog | MRDPETIETELMEIGAIADDTLKLERIIAWCASHPDEVPFALHQ |
| Ga0182016_102284341 | 3300014493 | Bog | MRDLEIIEAELMEISAIADDSIKLERIIAWCASHPDEVP |
| Ga0182017_103045684 | 3300014494 | Fen | MRDAETIETELMEISAIADDSVKLERIIAWCACYP |
| Ga0182011_107749532 | 3300014496 | Fen | MRDPETIETELMEISAIADDAVKLERIIAWCSCHPD |
| Ga0182019_101262872 | 3300014498 | Fen | MRDPEVIETELMEISAIADDSVKFERIVAWCATHPDEVPF |
| Ga0182012_109107242 | 3300014499 | Bog | MRDPEIIETELMEISAIPDDTLKFERIIAWCASHPDEVPF |
| Ga0182021_134115672 | 3300014502 | Fen | MRDLEIIEAELMEISAIADDSVKLERIIAWCASHP |
| Ga0182030_104554893 | 3300014838 | Bog | MRDPETIEQELVGIGAIADDSTKLERIIAWCASHPD |
| Ga0182027_102336461 | 3300014839 | Fen | MRDPESIETELMEISAIADDSVKFERIVVWCATHPDEVPFALHQLL |
| Ga0182027_108762142 | 3300014839 | Fen | MRDPETIETELMEISAIADDAVKLERIIAWCSCHPDEVPFALHQLMN |
| Ga0182027_109882441 | 3300014839 | Fen | MRDPETIETELMEISAIADDAVKLERIIAWCACHPDEVPFAL |
| Ga0132255_1041742901 | 3300015374 | Arabidopsis Rhizosphere | MRDPEIIETDLMEISAIADDLVKFERIVAWCASHPDEVPF |
| Ga0182034_107416541 | 3300016371 | Soil | VCHADFMRDPEIIDTELMEISAITDDVVKLERIIAWCASHPDEVPF |
| Ga0187848_103438461 | 3300017935 | Peatland | MRDSEIIETELMEISAIAEDTVKFERIVAWCATHPDEVPFALHQ |
| Ga0181520_101988941 | 3300017988 | Bog | MRDPEIIEAELMEISAIADDSIRFERIVAWCATYPDEVPFALHQWM |
| Ga0181520_109245592 | 3300017988 | Bog | MRDPESIETELMEISAIADESIKLERIIAWCASYPDEVLFAL |
| Ga0187878_13367692 | 3300018005 | Peatland | MRDPEIIETELMEISAIAEDTVKFERIVAWCATHPDEVP |
| Ga0187888_12789751 | 3300018008 | Peatland | MRDSEIIETELMEISAIAEDTVKFERIVAWCATHPDEVPFAL |
| Ga0187874_103617611 | 3300018019 | Peatland | MRDPEIIETELMEISAIAEDTTKFERIIAWCATHPDEVPFVLHQFM |
| Ga0187857_101010922 | 3300018026 | Peatland | MRDPEIIETELMEISAIAEDTVKFERIVAWCATHPDEV |
| Ga0187863_104636371 | 3300018034 | Peatland | MRDPEIIEAELVEISGIADDSVKLERIVTWCATHPDEVPFA |
| Ga0184628_101470231 | 3300018083 | Groundwater Sediment | MRDPEIIETDLMEISSIADDLVKFERIVAWCASHPDEVPFA |
| Ga0182031_12839023 | 3300019787 | Bog | MRDLEIIEAELMEISAIADDSIKLERIIAWCASHPDEVPVALH |
| Ga0182028_13527965 | 3300019788 | Fen | MRDPEAIETELMEISAIADDSVKFERIVAWCATHPDEVPSPCIRSWA |
| Ga0182028_13654913 | 3300019788 | Fen | MRDLEIIEAELMEISAIADDSIKLERIIAWCASHPTKSPSHCISS |
| Ga0210405_111736101 | 3300021171 | Soil | MREPETIENELIEIGAIPDDLVKFERIVAWCAAHPDEVPF |
| Ga0213874_104209611 | 3300021377 | Plant Roots | MRDPEIIEEELVEISAIADDTVKFDRIIAWCAAHPDEV |
| Ga0210402_109241331 | 3300021478 | Soil | MRDPEVIESELIEISAIADDTLKLERIIAWCTAHPDEIPFALHQ |
| Ga0210409_115253511 | 3300021559 | Soil | MRDPEIIENELMEISAIADDSLKLERIIAWCATHPNEVP |
| Ga0126371_133909632 | 3300021560 | Tropical Forest Soil | MRDPETIETELMEISAIPDDLVKLERIVAWCAAHPDEVPF |
| Ga0213853_104175872 | 3300021861 | Watersheds | MRQPDVIEAELAEISGIAEDETKFERIVAWVATHPD |
| Ga0224555_11996501 | 3300023088 | Soil | MRDPETIETELMEISSIVDDAVKFERVVTWCATHPDEVPFALHQ |
| Ga0224559_10770152 | 3300023091 | Soil | MRNPEIIETELMEISAIFDDTVKFERIIAWCASHPDE |
| Ga0209511_11561522 | 3300025147 | Glacier Valley | MRDAEAIESELLEISAIPDDSNKLERIITWCATHPD |
| Ga0208190_10446282 | 3300025473 | Peatland | MRDPEIIETELMEIGAIADDTLKLERIIAWCASHPD |
| Ga0208686_10885031 | 3300025500 | Peatland | MRDPETIETELMEISAIADDAVKLERIIAWCACHPD |
| Ga0207646_116359802 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDPEIIEAELVEISAIADDTIKFERIIAWCAAHPDEVAFALHQL |
| Ga0207687_103081961 | 3300025927 | Miscanthus Rhizosphere | MRDLQVIEAELVEIGAISDDSLKLERIIAWCATYPDEVPFAIRLLLDR |
| Ga0207664_119771562 | 3300025929 | Agricultural Soil | MRDPEIIEAELIEISAIADDSLKFERIVAWCTAHPDE |
| Ga0207703_112050012 | 3300026035 | Switchgrass Rhizosphere | MLVFMRDTEIIETDLMEISAIADDSTKFERILAWCAAHPDEIP |
| Ga0207641_110423072 | 3300026088 | Switchgrass Rhizosphere | MRDPQVIEAELVEIGAISDDSLKLERIIAWCATYPDEVPFAIRLLL |
| Ga0209863_100087441 | 3300026281 | Prmafrost Soil | MRDPEIIETELMEISAIADDTVKLERIIAWCASHPDEVPFALHQLMG |
| Ga0209517_106845801 | 3300027854 | Peatlands Soil | MGAPEIIETELMEISALAEDTVKFERIVAWCATHPDEVPFALHQL |
| Ga0209167_100425133 | 3300027867 | Surface Soil | VCHAEVSMRDPEIIETELMEISAIADDTIKFERIIAWCASHPDEVPFA |
| Ga0209698_102155672 | 3300027911 | Watersheds | MRDLDTVESELFEISAIPEDGLKLERIIAWCATHPDEVPMAIHLLLVRRNAETPKE |
| Ga0209168_101469821 | 3300027986 | Surface Soil | MRDAEIIEAELMEISAIVDDTVKLERIIAWCASYPDEV |
| Ga0302274_103164051 | 3300030041 | Bog | MRDLEIIEAELMEISAIADDSVKLERIIAWCASHPDE |
| Ga0311355_117600272 | 3300030580 | Palsa | MRNPEVIEAELMEISAIADDSTKLERIVTWCATHPDEVPF |
| Ga0302324_1023148982 | 3300031236 | Palsa | MRDSETIETELMEISAVADDTLKLERIIAWCASHPDEVPFALHQI |
| Ga0265332_101501892 | 3300031238 | Rhizosphere | MRDPEIIETELMEISAIADDAVKLERIVAWCAMRPDEV |
| Ga0265331_103603911 | 3300031250 | Rhizosphere | MRAPEIIETELMEISAIAEDTVKFERIVVWCATHP |
| Ga0302187_101205972 | 3300031259 | Bog | MRDPEIIETELMEISAIAEDTVKFERIVAWCATHPDEVPF |
| Ga0310686_1109187911 | 3300031708 | Soil | MRDPETIETELMSISAIADDSTKLERIIAWCATHPDEVPFALH |
| Ga0310813_117870661 | 3300031716 | Soil | MRDPEVIEAELMEISGTADDTIKLERIIAWCASHPDEVPFALHQLL |
| Ga0318554_108424522 | 3300031765 | Soil | MRDPETIETELMEISAIADDAVKLERIIAWCAAHPDEVPFA |
| Ga0318567_101933621 | 3300031821 | Soil | MRDPEIIDTELMEISAITDDVVKLERIIAWCASHPDEVPF |
| Ga0308175_1016244243 | 3300031938 | Soil | MRDPEVIENELMEISAIADESIKFERIVAWCASHPDEVPF |
| Ga0308175_1017562991 | 3300031938 | Soil | MCHPKVAMRAPEIIEAELMEIGAIADDTIKLERIIAWCASHPD |
| Ga0308175_1026839011 | 3300031938 | Soil | MRDPETIETELMEISAITDDVVKLERIIAWCAIHPDEV |
| Ga0308174_101881271 | 3300031939 | Soil | MRDPEIIETELMEIGSIADDGVKLERLIAWCASHPDEV |
| Ga0308176_103708022 | 3300031996 | Soil | MRDPEVIEAELMEISGIAEDENKLERIIAWCATHPDEVPFALKI |
| Ga0318524_105166292 | 3300032067 | Soil | MRDAETIETELVEIAAIPDDLVKLERIITWCAVHPDEVPFAL |
| Ga0308173_106947462 | 3300032074 | Soil | MRRDQQIVEAELMEISAIQDDSVKLERLVAWCANYPDEILFAL |
| Ga0306924_101110291 | 3300032076 | Soil | MRDPEIIDTELMEISAIADDGVKLERLIAWCAAHP |
| Ga0307471_1000739493 | 3300032180 | Hardwood Forest Soil | MRDPEIIEAELTEISAIADDTVKLERIIAWCATHPDEVAFALHQFM |
| Ga0335085_120210461 | 3300032770 | Soil | MRDPEIIEGELIEISALADDTLKLERIIAWCAAHHDEIPFALHM |
| Ga0335082_115672681 | 3300032782 | Soil | MRPPEVIEADLMEISAVLDDAVKLERIIAWCAAHPDEVPFAL |
| Ga0335079_105652581 | 3300032783 | Soil | MRDPETIETELMEISAIADESIKLERIIAWCASHPDEVPFA |
| Ga0335078_101593311 | 3300032805 | Soil | MRDSEIIETELMEISAIADDSIKLERIIAWCASHPDEVP |
| Ga0335078_117363592 | 3300032805 | Soil | MRDPQIIDAELMEIAALADDTLKFERLVAWCASHP |
| Ga0335074_110776712 | 3300032895 | Soil | MRDPQVIEEELIEIGAIADDTIKFERIVAWCATHPDEVPLALHMF |
| Ga0335071_116340043 | 3300032897 | Soil | MRDPETIEAELMEISAIADDAVKLERIVAWCAWHPDEVPFAL |
| Ga0335071_121556451 | 3300032897 | Soil | MRDPEIIETELMEISAIADDSIKLERIIAWCASHPDEVPF |
| Ga0335083_100799291 | 3300032954 | Soil | MRPPEVIEADLMEISAVLDDAVKLERIIAWCAAHPD |
| Ga0335077_100531503 | 3300033158 | Soil | MRDSEIIETELMEISAIADDSIKLERIIAWCASHPDEVPMPCISS |
| Ga0326728_103914981 | 3300033402 | Peat Soil | MRDPETIETELMEIGAIAEDAVKLERIIAWCACHPD |
| Ga0316628_1022585811 | 3300033513 | Soil | MRDPETIEPELMEISSIADDLGKFERVVAWCAAHPDEVPSPC |
| Ga0334811_139611_2_124 | 3300033891 | Soil | MRDAEIVEAELMEISAIADDSIKFERIVAWCATYPEEVPFA |
| Ga0370497_0169754_1_123 | 3300034965 | Untreated Peat Soil | MRDPETIDTELMEISAITDDVLKLERIITWCATHPDEVPFA |
| ⦗Top⦘ |