


| Basic Information | |
|---|---|
| Family ID | F079115 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.03 % |
| % of genes near scaffold ends (potentially truncated) | 93.10 % |
| % of genes from short scaffolds (< 2000 bps) | 92.24 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.690 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.310 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.13% β-sheet: 0.00% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 41.38 |
| PF04392 | ABC_sub_bind | 3.45 |
| PF00903 | Glyoxalase | 3.45 |
| PF01569 | PAP2 | 2.59 |
| PF00355 | Rieske | 2.59 |
| PF00582 | Usp | 1.72 |
| PF13189 | Cytidylate_kin2 | 1.72 |
| PF00072 | Response_reg | 0.86 |
| PF08445 | FR47 | 0.86 |
| PF05598 | DUF772 | 0.86 |
| PF07681 | DoxX | 0.86 |
| PF04191 | PEMT | 0.86 |
| PF02586 | SRAP | 0.86 |
| PF01135 | PCMT | 0.86 |
| PF14347 | DUF4399 | 0.86 |
| PF00753 | Lactamase_B | 0.86 |
| PF02738 | MoCoBD_1 | 0.86 |
| PF13924 | Lipocalin_5 | 0.86 |
| PF13185 | GAF_2 | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 41.38 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.45 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.86 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.86 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.86 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.86 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.69 % |
| Unclassified | root | N/A | 4.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002223|C687J26845_10262661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300004051|Ga0055492_10109563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300004145|Ga0055489_10181307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300004463|Ga0063356_101632481 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300004633|Ga0066395_10077884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1545 | Open in IMG/M |
| 3300004633|Ga0066395_10831489 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005186|Ga0066676_10756505 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005205|Ga0068999_10093037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300005344|Ga0070661_101217447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300005355|Ga0070671_101364875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300005356|Ga0070674_100145471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1783 | Open in IMG/M |
| 3300005554|Ga0066661_10262979 | Not Available | 1067 | Open in IMG/M |
| 3300005719|Ga0068861_102390424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300005764|Ga0066903_100524421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2019 | Open in IMG/M |
| 3300005843|Ga0068860_101791699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
| 3300006034|Ga0066656_10199545 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300006173|Ga0070716_100483034 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300006755|Ga0079222_11728339 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006853|Ga0075420_100732058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300006871|Ga0075434_102082294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300006903|Ga0075426_10960188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 645 | Open in IMG/M |
| 3300009012|Ga0066710_102052661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300009089|Ga0099828_10709716 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 903 | Open in IMG/M |
| 3300009094|Ga0111539_10202895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2312 | Open in IMG/M |
| 3300009100|Ga0075418_12902172 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300009157|Ga0105092_10062583 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300009162|Ga0075423_10609985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300009167|Ga0113563_10864408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300009609|Ga0105347_1104142 | Not Available | 1073 | Open in IMG/M |
| 3300009792|Ga0126374_10102999 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300009792|Ga0126374_10125666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20 | 1509 | Open in IMG/M |
| 3300009792|Ga0126374_10372160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 988 | Open in IMG/M |
| 3300009792|Ga0126374_11789707 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 513 | Open in IMG/M |
| 3300009810|Ga0105088_1025029 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009816|Ga0105076_1048905 | Not Available | 765 | Open in IMG/M |
| 3300009817|Ga0105062_1040171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300010047|Ga0126382_10256438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20 | 1285 | Open in IMG/M |
| 3300010047|Ga0126382_10811490 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010047|Ga0126382_12342601 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010048|Ga0126373_11164075 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010048|Ga0126373_12297850 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 600 | Open in IMG/M |
| 3300010048|Ga0126373_12587747 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010304|Ga0134088_10088920 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300010304|Ga0134088_10144362 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300010304|Ga0134088_10702537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010335|Ga0134063_10154712 | Not Available | 1065 | Open in IMG/M |
| 3300010359|Ga0126376_10349561 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300010359|Ga0126376_10933487 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300010362|Ga0126377_10063176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3267 | Open in IMG/M |
| 3300010376|Ga0126381_103835150 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010413|Ga0136851_10417108 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300011269|Ga0137392_10298106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1332 | Open in IMG/M |
| 3300011405|Ga0137340_1047819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300011430|Ga0137423_1256331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300012038|Ga0137431_1020107 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300012202|Ga0137363_10612138 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012202|Ga0137363_10725386 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300012204|Ga0137374_10267429 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300012205|Ga0137362_10139776 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300012210|Ga0137378_10275632 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300012351|Ga0137386_10176872 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300012360|Ga0137375_10625319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300012360|Ga0137375_11153993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300012685|Ga0137397_10720026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300012929|Ga0137404_10399752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1211 | Open in IMG/M |
| 3300012930|Ga0137407_11244970 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012948|Ga0126375_11848801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300012971|Ga0126369_10339880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20 | 1519 | Open in IMG/M |
| 3300013306|Ga0163162_13000495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300014300|Ga0075321_1138992 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015371|Ga0132258_10249611 | All Organisms → cellular organisms → Bacteria | 4337 | Open in IMG/M |
| 3300015371|Ga0132258_11154548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1958 | Open in IMG/M |
| 3300015373|Ga0132257_100407558 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300016422|Ga0182039_10310598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1310 | Open in IMG/M |
| 3300017966|Ga0187776_11128487 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018027|Ga0184605_10294782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300018053|Ga0184626_10360845 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018054|Ga0184621_10121932 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300018073|Ga0184624_10366128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300018081|Ga0184625_10537045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300018083|Ga0184628_10422753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300018422|Ga0190265_12751965 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300019208|Ga0180110_1019151 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300019249|Ga0184648_1338338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300019259|Ga0184646_1278742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300019361|Ga0173482_10025533 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300021560|Ga0126371_11921948 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300022195|Ga0222625_1417727 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300024056|Ga0124853_1211109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2311 | Open in IMG/M |
| 3300024516|Ga0209980_10048151 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300024516|Ga0209980_10107853 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300025319|Ga0209520_10599023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300025324|Ga0209640_11194939 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025931|Ga0207644_10650528 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300025945|Ga0207679_10276789 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300025971|Ga0210102_1079943 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026078|Ga0207702_10226576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1744 | Open in IMG/M |
| 3300026548|Ga0209161_10250953 | Not Available | 920 | Open in IMG/M |
| 3300027032|Ga0209877_1018083 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027552|Ga0209982_1092027 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027722|Ga0209819_10029989 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300027909|Ga0209382_10995765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 874 | Open in IMG/M |
| 3300027952|Ga0209889_1032857 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300027957|Ga0209857_1062686 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027957|Ga0209857_1089885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300028597|Ga0247820_11167946 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300030620|Ga0302046_10878775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300031058|Ga0308189_10556594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031716|Ga0310813_11791904 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031941|Ga0310912_10762006 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 749 | Open in IMG/M |
| 3300031965|Ga0326597_11071974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 807 | Open in IMG/M |
| 3300032012|Ga0310902_11314779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300033412|Ga0310810_10212362 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
| 3300033412|Ga0310810_10331621 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300034176|Ga0364931_0169164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300034177|Ga0364932_0047910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.45% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014300 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26845_102626612 | 3300002223 | Soil | IVVEADSPEPIHKFMASIQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0055492_101095632 | 3300004051 | Natural And Restored Wetlands | YTPTGPHDAAIFIEAEGPEPINRFMANTQSMGNTKMKFVRAFSIDEMRKML* |
| Ga0055489_101813072 | 3300004145 | Natural And Restored Wetlands | PGGPNDAAMIIEAEGPEPIHKLMASIQSLGNVKLKFVRTFSIEEMRKMV* |
| Ga0063356_1016324813 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIAAIIIEAEGPETINKFMSSVQSLGNVKMKFIRAFSIEEMRKML* |
| Ga0066395_100778841 | 3300004633 | Tropical Forest Soil | GPHDAAIVIEAEGPEPINKLMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0066395_108314892 | 3300004633 | Tropical Forest Soil | HDAAMIIEAEGPEPIHKFMASVQSLGNVRMKFVRTFSIEEMRKML* |
| Ga0066676_107565052 | 3300005186 | Soil | HDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIDEMRKMV* |
| Ga0068999_100930372 | 3300005205 | Natural And Restored Wetlands | VEAEGPESINKFMASVQSLGNVKMKFIRAFSIDEMRKMV* |
| Ga0070661_1012174472 | 3300005344 | Corn Rhizosphere | TPSGPHDAAIVIEAEGPEPINKLMCTVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0070671_1013648752 | 3300005355 | Switchgrass Rhizosphere | AIVIEAEGPEPINKLMCTVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0070674_1001454711 | 3300005356 | Miscanthus Rhizosphere | GPHDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD* |
| Ga0066661_102629794 | 3300005554 | Soil | FYTPGGPHDAAIIIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV* |
| Ga0068861_1023904242 | 3300005719 | Switchgrass Rhizosphere | VEAEGPEPIHKFISSVQSLGNVKMKFIRAFSIDEMRKMV* |
| Ga0066903_1005244212 | 3300005764 | Tropical Forest Soil | MIIEAEGPEPIHKFMASVQSLGNVRMKFVRTFSIEEMRKML* |
| Ga0068860_1017916992 | 3300005843 | Switchgrass Rhizosphere | HDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD* |
| Ga0066656_101995453 | 3300006034 | Soil | FYTPGGPHDAAILIEAESPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0070716_1004830341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0079222_117283391 | 3300006755 | Agricultural Soil | GPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVHD* |
| Ga0075420_1007320581 | 3300006853 | Populus Rhizosphere | GPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRVFSIEEMRKMV* |
| Ga0075434_1020822941 | 3300006871 | Populus Rhizosphere | GSHDAAIVIEAERPGPINKLMCSVQSLGNVKMKFVRAFSIDEMRKMVRD* |
| Ga0075426_109601882 | 3300006903 | Populus Rhizosphere | KDLFYTPGGPHDAAIVIEAEGPEPINKFMSSIQSLGNVKMKFIRTFSVEEMRKMV* |
| Ga0066710_1020526612 | 3300009012 | Grasslands Soil | FYTPGGQHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0099828_107097161 | 3300009089 | Vadose Zone Soil | IEAEGPEPINKLMASIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0111539_102028954 | 3300009094 | Populus Rhizosphere | PSGPHDAAIVIEAEGPEPINKLMCTVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0075418_129021721 | 3300009100 | Populus Rhizosphere | IIEAEGSESINKFMCSIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0105092_100625831 | 3300009157 | Freshwater Sediment | DAAIIIEADGPEPINKFMSSIQSLGNVKMKFIRAFSIEEMRKMI* |
| Ga0075423_106099854 | 3300009162 | Populus Rhizosphere | AIVVEAEGPEPIHKFISSIQSLGNVKMKFIRVFTIEEMRKMV* |
| Ga0113563_108644083 | 3300009167 | Freshwater Wetlands | FFTPGGPHDAAMVVEADGPEPIHKLMSSIQSLGNVKLKFIRAFSIEEMRKMV* |
| Ga0105347_11041421 | 3300009609 | Soil | MVVEADGPEPIHKLMSSIQSLGNVKLKFIRAFSIEEMRKMV* |
| Ga0126374_101029993 | 3300009792 | Tropical Forest Soil | VYTPGGPHDASIVIEAEGPEPIHKFMASVQSLGNVKMKFIRTFSIEEMRKML* |
| Ga0126374_101256665 | 3300009792 | Tropical Forest Soil | GPHDAAIVIEAEGPEPIHKFMANIQSLGHVKMKFVRAFSIDEMRKMV* |
| Ga0126374_103721601 | 3300009792 | Tropical Forest Soil | GPHDAAIVIEAEGPEPIHKFMANIQSLGHVKMKFVRAFSIEEMRKMV* |
| Ga0126374_117897072 | 3300009792 | Tropical Forest Soil | HDASIVIEAEGPEPIHKFMASVQSLGNVKMKFVRAFSIEEMRKML* |
| Ga0105088_10250293 | 3300009810 | Groundwater Sand | AEGPEPINKFMASLQSLGNVKLKFIRAFSIEEMRKMV* |
| Ga0105076_10489051 | 3300009816 | Groundwater Sand | AEGPEPINKLMSNIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0105062_10401712 | 3300009817 | Groundwater Sand | EAEGPEPINKFMSSVQSLGNVKMKFIRTFSVEEMRKMV* |
| Ga0126382_102564383 | 3300010047 | Tropical Forest Soil | EGPEPIHKFMANIQSLGHVKMKFVRAFSIDEMRKMV* |
| Ga0126382_108114902 | 3300010047 | Tropical Forest Soil | KVNVKDVHFTPGGPHDAAMAIEAEGPEPIHKFMASVQSLGNVKMKFVRTFSIEEMRKML* |
| Ga0126382_123426011 | 3300010047 | Tropical Forest Soil | TPGGPHDAAIVIEAEGPEPIHKFMSSVQSLGHVKMKFVRAFSIEEMRKMI* |
| Ga0126373_111640751 | 3300010048 | Tropical Forest Soil | TPGGPHDAAIVIEAEGPEPINKLMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0126373_122978502 | 3300010048 | Tropical Forest Soil | QVKDLVYTPGGPHDASIVIEAEGPEPIHKFMASVQSLGNVKMKFVRTFSIEEMRKML* |
| Ga0126373_125877471 | 3300010048 | Tropical Forest Soil | EAEGPEPINKFLASVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0134088_100889203 | 3300010304 | Grasslands Soil | HDAAILIEAESPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0134088_101443622 | 3300010304 | Grasslands Soil | AIIIEAEGPEPINKFMASIQSLGNVKMKFIRAFSVEEMRKMV* |
| Ga0134088_107025372 | 3300010304 | Grasslands Soil | VAEGPESINKFMSSVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0134063_101547122 | 3300010335 | Grasslands Soil | DAAIIIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV* |
| Ga0126376_103495614 | 3300010359 | Tropical Forest Soil | YTPGGPHDAAMVIEAEGPEPIHKFMASVQALGNVKMKFVRAFSIEEMRKMV* |
| Ga0126376_109334871 | 3300010359 | Tropical Forest Soil | AEGPEPIHKFMANIQSLGNVKMKFIRAFSIEEMRKIV* |
| Ga0126377_100631766 | 3300010362 | Tropical Forest Soil | AKKLKVNVKDVHFTPGGPHDAAMAIEAEGPEPIHKFMASVQSLGNVKMKFVLTFSIEEMRKML* |
| Ga0126381_1038351501 | 3300010376 | Tropical Forest Soil | HDAAIVIEAEGPEPINKLMSSVQSLGNLKMKFIRAFSIEEMRKIV* |
| Ga0136851_104171083 | 3300010413 | Mangrove Sediment | MFIEAESPGPIQKFMASVQSLGNVKMKFVRAFSIEEMRKVV* |
| Ga0137392_102981062 | 3300011269 | Vadose Zone Soil | DAAILIEAEGPEPINKLMASIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137340_10478193 | 3300011405 | Soil | EAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137423_12563312 | 3300011430 | Soil | GPHDAAIVVEAEGPEPIHKFISSVQSLGNVKMKFIRTFSVEEMRKMV* |
| Ga0137431_10201074 | 3300012038 | Soil | HDAAIVVEAEGPESINKFMASVQSLGNVKMKFIRAFSIEAMRKMV* |
| Ga0137363_106121383 | 3300012202 | Vadose Zone Soil | MVVEAEGPEPIHKLMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137363_107253862 | 3300012202 | Vadose Zone Soil | PEPINKFMSSIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137374_102674291 | 3300012204 | Vadose Zone Soil | ILIEAESPEPINKFMSSIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137362_101397763 | 3300012205 | Vadose Zone Soil | MVVEAEGPEPIHKLMSSVQSLGNVKMKFMRAFSIEEMRKMV* |
| Ga0137378_102756324 | 3300012210 | Vadose Zone Soil | AAILIEAESPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137386_101768721 | 3300012351 | Vadose Zone Soil | DVFYTPGGPHDAAIVIEAEGPEPINKFMASVQSLGNVKMKFIRTFSIDEMRKMV* |
| Ga0137375_106253192 | 3300012360 | Vadose Zone Soil | PEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV* |
| Ga0137375_111539931 | 3300012360 | Vadose Zone Soil | GGPHDAAIVIEAEGPEPINKFMSSVQSLGNVEMKFIRAFSTDEMRKMV* |
| Ga0137397_107200262 | 3300012685 | Vadose Zone Soil | FYTPGGPHDAAIIIEAEGPEPINKLMSSIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137404_103997521 | 3300012929 | Vadose Zone Soil | DAAIIIEAEGPEPINKLMSSIQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0137407_112449701 | 3300012930 | Vadose Zone Soil | IEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV* |
| Ga0126375_118488011 | 3300012948 | Tropical Forest Soil | DLFYTPGGPHDAAIVIEAEGPEPIHKFMSSVQSLGHVKMKFVRAFSIEEMRKMV* |
| Ga0126369_103398801 | 3300012971 | Tropical Forest Soil | DAAIVIEAEGPEPIHKFMANIQSLGHVKMKFVRAFSIDEMRKMV* |
| Ga0163162_130004951 | 3300013306 | Switchgrass Rhizosphere | GPHDAAIVIEAEGPEPINKLMCTVQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0075321_11389921 | 3300014300 | Natural And Restored Wetlands | PEPIHKFMGSTQSLGNVRVKFVRAFSIEEMRKMV* |
| Ga0132258_102496111 | 3300015371 | Arabidopsis Rhizosphere | PHDAAIVIEAEGPEPIHKFMASIQSLGNVKMKFVRAFSIEEMRKIV* |
| Ga0132258_111545481 | 3300015371 | Arabidopsis Rhizosphere | MLIEAEGPEPINKLMCSIQSLGNVKMKFVRAFSIEEMRKMV* |
| Ga0132257_1004075581 | 3300015373 | Arabidopsis Rhizosphere | MLIEAEGPEPINKLMCSIQSLGNVKMKFVRAFSIEEMRKMVRD* |
| Ga0182039_103105981 | 3300016422 | Soil | DAAIVIEAEGPEPIHKFMANIQSLGNVKMKFVRAFSIEEMRKMV |
| Ga0187776_111284871 | 3300017966 | Tropical Peatland | AEGPEPIHKFMASIQSLGNVKMKFVRAFSIEEMRKIV |
| Ga0184605_102947821 | 3300018027 | Groundwater Sediment | IVIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSVEEMRKMV |
| Ga0184626_103608451 | 3300018053 | Groundwater Sediment | LFYTPGGPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0184621_101219323 | 3300018054 | Groundwater Sediment | DAAIVIEAEGPEPINKFMSSVQSLGNVKLKFIRAFSVEEMRKMV |
| Ga0184624_103661281 | 3300018073 | Groundwater Sediment | GPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSVDEMRKMV |
| Ga0184625_105370452 | 3300018081 | Groundwater Sediment | FFTPGGPHDAAMVVEAEGPEPIHKFMSSIQSLGNVKMKFIRAFSIDEMRKMV |
| Ga0184628_104227533 | 3300018083 | Groundwater Sediment | EAEGPEPIHKFISSVQSLGNVKMKFIRAFSIDEMRKMV |
| Ga0190265_127519652 | 3300018422 | Soil | IEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0180110_10191511 | 3300019208 | Groundwater Sediment | HDAAIVVEAEGPESIHKFMASVQSLGNVKMKFIRAFSIDEMRKMV |
| Ga0184648_13383382 | 3300019249 | Groundwater Sediment | AAMIIEAEGPESINKLMASVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0184646_12787422 | 3300019259 | Groundwater Sediment | DAAIVVEAEGPEPINKFMSSIQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0173482_100255334 | 3300019361 | Soil | PHDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD |
| Ga0126371_119219482 | 3300021560 | Tropical Forest Soil | GPEPINKFLASVQSLGNVKMKFVRAFSIEEMRKMV |
| Ga0222625_14177272 | 3300022195 | Groundwater Sediment | AIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSVEEMRKMV |
| Ga0124853_12111092 | 3300024056 | Freshwater Wetlands | MVVEAEGPEPIHKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0209980_100481511 | 3300024516 | Deep Subsurface | FTPSGPHDAAIVVEAESREPIGKFMSSVQSLGNVKMTFIRTFSIEEMRKMV |
| Ga0209980_101078531 | 3300024516 | Deep Subsurface | QVKDILFTPSGPHDAAIVVEAESREPIGKFMSSVQSLGNVKMKFVRGFSIEEMRKMV |
| Ga0209520_105990233 | 3300025319 | Soil | VEAEGPEPINRFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0209640_111949391 | 3300025324 | Soil | AEGPEPINKLMSNIQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0207644_106505281 | 3300025931 | Switchgrass Rhizosphere | TPGGPHDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD |
| Ga0207679_102767892 | 3300025945 | Corn Rhizosphere | VQVRVLFYTPGGSHDAAIVIEAERPGPINKLMCSVQSLGNVKMKFVRAFSIDEMRKMVRD |
| Ga0210102_10799432 | 3300025971 | Natural And Restored Wetlands | SKADAAKLGLQVRDLFYTPSGPHDAAIFIEAEGPEPINKFMANTQSMGNTKMKFVRAFSIDEMRRML |
| Ga0207702_102265761 | 3300026078 | Corn Rhizosphere | FYTPGGPHDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD |
| Ga0209161_102509532 | 3300026548 | Soil | IFYTPGGPHDAAIIIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV |
| Ga0209877_10180831 | 3300027032 | Groundwater Sand | FYTPGGPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0209982_10920271 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MIAAIIIEAEGPETINKFMSSVQSLGNVKMKFIRAFSIEEMRKML |
| Ga0209819_100299892 | 3300027722 | Freshwater Sediment | MHFVFSVARNLKGGQHDAAILIEAEGPEPINKFMSSVQSLGNVKMKFVRAFSIEEMRKMV |
| Ga0209382_109957653 | 3300027909 | Populus Rhizosphere | GPESINKFMSSVQSLGNVKMKFIRAFSIEEMRKMI |
| Ga0209889_10328571 | 3300027952 | Groundwater Sand | IIEAEGPEPINKFMASVQSLGNVKLKFIRAFSIEEMRKMV |
| Ga0209857_10626862 | 3300027957 | Groundwater Sand | AAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMV |
| Ga0209857_10898852 | 3300027957 | Groundwater Sand | FYTPGGPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV |
| Ga0247820_111679461 | 3300028597 | Soil | DGPEPINKFMSSVQSLGNVKMKFIRAFSIEEMRKMI |
| Ga0302046_108787752 | 3300030620 | Soil | PIHKCMASIQSLGNVKMKFVRAFSIEEMRKMVSSG |
| Ga0308189_105565941 | 3300031058 | Soil | PHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSVEEMRKMV |
| Ga0310813_117919041 | 3300031716 | Soil | PGGPHDAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIEEMRKMVRD |
| Ga0310912_107620062 | 3300031941 | Soil | GPEPIHKFMVSVQSLGNVKMKFVRTFSIEEMRKML |
| Ga0326597_110719743 | 3300031965 | Soil | IEAEGPEPINKFLASVQSLGNVKMKFIRAFSVDEMRKMV |
| Ga0310902_113147791 | 3300032012 | Soil | DAAIVIEAEGPEPINKLMCSVQSLGNVKMKFVRAFSIEEMRKMV |
| Ga0310810_102123621 | 3300033412 | Soil | PEPINKLMCSVQSLGNVKMKFVRAFSIEEMRKMVRD |
| Ga0310810_103316211 | 3300033412 | Soil | EAEGPEPINKLMCSVQSLGNVKMKFVRAFSIDEMRRMVRD |
| Ga0364931_0169164_1_162 | 3300034176 | Sediment | VFYTPGGPHDAAIVIEAEGPEPINKFMSSVQSLGNVKMKFIRTFSIEEMRKMV |
| Ga0364932_0047910_1_129 | 3300034177 | Sediment | AIVVEAEGPEPIHKFISSVQSLGNVKMKFIRAFSIEEMRKMV |
| ⦗Top⦘ |