


| Basic Information | |
|---|---|
| Family ID | F079047 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 116 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRKTANSGAEAA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 116 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.34 % |
| % of genes near scaffold ends (potentially truncated) | 37.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.38 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.862 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (22.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 116 Family Scaffolds |
|---|---|---|
| PF00857 | Isochorismatase | 33.62 |
| PF00135 | COesterase | 16.38 |
| PF00211 | Guanylate_cyc | 5.17 |
| PF07859 | Abhydrolase_3 | 5.17 |
| PF04095 | NAPRTase | 0.86 |
| PF01402 | RHH_1 | 0.86 |
| PF12697 | Abhydrolase_6 | 0.86 |
| PF05683 | Fumerase_C | 0.86 |
| COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 33.62 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 33.62 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 16.38 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 5.17 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 5.17 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.86 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.86 % |
| Unclassified | root | N/A | 49.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10195459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300005332|Ga0066388_100733508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
| 3300005332|Ga0066388_100803925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1532 | Open in IMG/M |
| 3300005332|Ga0066388_100842095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1504 | Open in IMG/M |
| 3300005332|Ga0066388_100939183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300005363|Ga0008090_10170064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2365 | Open in IMG/M |
| 3300005436|Ga0070713_100485880 | Not Available | 1164 | Open in IMG/M |
| 3300005554|Ga0066661_10294751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1000 | Open in IMG/M |
| 3300005764|Ga0066903_100246046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2751 | Open in IMG/M |
| 3300005764|Ga0066903_104816554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300005764|Ga0066903_107671898 | Not Available | 556 | Open in IMG/M |
| 3300005764|Ga0066903_107699359 | Not Available | 554 | Open in IMG/M |
| 3300005764|Ga0066903_107772108 | Not Available | 551 | Open in IMG/M |
| 3300005764|Ga0066903_108740932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300006046|Ga0066652_100887775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300006057|Ga0075026_100275954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300006174|Ga0075014_100994630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300006755|Ga0079222_10192291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300006806|Ga0079220_10311873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 978 | Open in IMG/M |
| 3300009792|Ga0126374_10266525 | Not Available | 1128 | Open in IMG/M |
| 3300010043|Ga0126380_11281211 | Not Available | 637 | Open in IMG/M |
| 3300010046|Ga0126384_10097653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2159 | Open in IMG/M |
| 3300010048|Ga0126373_10033005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4494 | Open in IMG/M |
| 3300010048|Ga0126373_10311617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1573 | Open in IMG/M |
| 3300010048|Ga0126373_10636927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300010303|Ga0134082_10330359 | Not Available | 643 | Open in IMG/M |
| 3300010358|Ga0126370_10922362 | Not Available | 790 | Open in IMG/M |
| 3300010359|Ga0126376_11258866 | Not Available | 758 | Open in IMG/M |
| 3300010360|Ga0126372_11365541 | Not Available | 740 | Open in IMG/M |
| 3300010360|Ga0126372_11488132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 712 | Open in IMG/M |
| 3300010361|Ga0126378_10381805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 1520 | Open in IMG/M |
| 3300010361|Ga0126378_10627100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300010366|Ga0126379_12018105 | Not Available | 679 | Open in IMG/M |
| 3300010366|Ga0126379_12880563 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010376|Ga0126381_100408332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1894 | Open in IMG/M |
| 3300010376|Ga0126381_100955834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1235 | Open in IMG/M |
| 3300010376|Ga0126381_101417325 | Not Available | 1004 | Open in IMG/M |
| 3300010376|Ga0126381_101679390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300010398|Ga0126383_10487086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300012181|Ga0153922_1166489 | Not Available | 520 | Open in IMG/M |
| 3300012208|Ga0137376_11574045 | Not Available | 548 | Open in IMG/M |
| 3300012210|Ga0137378_11006291 | Not Available | 747 | Open in IMG/M |
| 3300012211|Ga0137377_10964332 | Not Available | 784 | Open in IMG/M |
| 3300012971|Ga0126369_10417558 | Not Available | 1383 | Open in IMG/M |
| 3300012971|Ga0126369_12607765 | Not Available | 590 | Open in IMG/M |
| 3300012971|Ga0126369_13234806 | Not Available | 533 | Open in IMG/M |
| 3300014157|Ga0134078_10054396 | Not Available | 1395 | Open in IMG/M |
| 3300014501|Ga0182024_10332014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1994 | Open in IMG/M |
| 3300015373|Ga0132257_101643800 | Not Available | 822 | Open in IMG/M |
| 3300016319|Ga0182033_11005059 | Not Available | 742 | Open in IMG/M |
| 3300016341|Ga0182035_10170084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1695 | Open in IMG/M |
| 3300016357|Ga0182032_10196934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1531 | Open in IMG/M |
| 3300016371|Ga0182034_10067731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2436 | Open in IMG/M |
| 3300016371|Ga0182034_11860848 | Not Available | 531 | Open in IMG/M |
| 3300016445|Ga0182038_10131766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1877 | Open in IMG/M |
| 3300017927|Ga0187824_10217537 | Not Available | 654 | Open in IMG/M |
| 3300017932|Ga0187814_10091512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1120 | Open in IMG/M |
| 3300017936|Ga0187821_10029807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1924 | Open in IMG/M |
| 3300017936|Ga0187821_10090744 | Not Available | 1120 | Open in IMG/M |
| 3300017937|Ga0187809_10026194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1862 | Open in IMG/M |
| 3300017937|Ga0187809_10136369 | Not Available | 842 | Open in IMG/M |
| 3300017966|Ga0187776_10315227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300017973|Ga0187780_10872810 | Not Available | 653 | Open in IMG/M |
| 3300017974|Ga0187777_10780380 | Not Available | 682 | Open in IMG/M |
| 3300018058|Ga0187766_10060597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2240 | Open in IMG/M |
| 3300018062|Ga0187784_10188287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 1685 | Open in IMG/M |
| 3300018085|Ga0187772_10144675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1567 | Open in IMG/M |
| 3300019888|Ga0193751_1009355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5227 | Open in IMG/M |
| 3300019888|Ga0193751_1060348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1588 | Open in IMG/M |
| 3300020580|Ga0210403_10076909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2685 | Open in IMG/M |
| 3300021168|Ga0210406_10116333 | Not Available | 2263 | Open in IMG/M |
| 3300021476|Ga0187846_10328330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300021478|Ga0210402_12006805 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300021560|Ga0126371_10258586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1857 | Open in IMG/M |
| 3300021560|Ga0126371_10942820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1006 | Open in IMG/M |
| 3300021560|Ga0126371_11483445 | Not Available | 807 | Open in IMG/M |
| 3300021560|Ga0126371_12154650 | Not Available | 672 | Open in IMG/M |
| 3300025906|Ga0207699_11296221 | Not Available | 539 | Open in IMG/M |
| 3300026847|Ga0207802_1007231 | Not Available | 1016 | Open in IMG/M |
| 3300026981|Ga0207822_1021206 | Not Available | 705 | Open in IMG/M |
| 3300027042|Ga0207766_1018391 | Not Available | 791 | Open in IMG/M |
| 3300027516|Ga0207761_1082282 | Not Available | 626 | Open in IMG/M |
| 3300027703|Ga0207862_1146487 | Not Available | 706 | Open in IMG/M |
| 3300027775|Ga0209177_10506581 | Not Available | 504 | Open in IMG/M |
| 3300027787|Ga0209074_10493465 | Not Available | 530 | Open in IMG/M |
| 3300027824|Ga0209040_10262910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 859 | Open in IMG/M |
| 3300027911|Ga0209698_11240868 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031057|Ga0170834_110128574 | Not Available | 1113 | Open in IMG/M |
| 3300031231|Ga0170824_126927645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1583 | Open in IMG/M |
| 3300031234|Ga0302325_11946166 | Not Available | 728 | Open in IMG/M |
| 3300031543|Ga0318516_10422518 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300031543|Ga0318516_10732505 | Not Available | 560 | Open in IMG/M |
| 3300031544|Ga0318534_10446349 | Not Available | 741 | Open in IMG/M |
| 3300031544|Ga0318534_10645561 | Not Available | 600 | Open in IMG/M |
| 3300031546|Ga0318538_10417498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 726 | Open in IMG/M |
| 3300031549|Ga0318571_10459994 | Not Available | 506 | Open in IMG/M |
| 3300031564|Ga0318573_10383721 | Not Available | 755 | Open in IMG/M |
| 3300031572|Ga0318515_10459409 | Not Available | 681 | Open in IMG/M |
| 3300031679|Ga0318561_10458082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica | 702 | Open in IMG/M |
| 3300031680|Ga0318574_10725090 | Not Available | 583 | Open in IMG/M |
| 3300031751|Ga0318494_10143355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1342 | Open in IMG/M |
| 3300031763|Ga0318537_10210878 | Not Available | 722 | Open in IMG/M |
| 3300031764|Ga0318535_10558626 | Not Available | 507 | Open in IMG/M |
| 3300031765|Ga0318554_10474182 | Not Available | 709 | Open in IMG/M |
| 3300031771|Ga0318546_10447353 | Not Available | 904 | Open in IMG/M |
| 3300031799|Ga0318565_10176920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
| 3300031823|Ga0307478_10202296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1599 | Open in IMG/M |
| 3300031833|Ga0310917_10557966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 778 | Open in IMG/M |
| 3300031859|Ga0318527_10287401 | Not Available | 700 | Open in IMG/M |
| 3300031910|Ga0306923_11436435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300032041|Ga0318549_10358026 | Not Available | 657 | Open in IMG/M |
| 3300032066|Ga0318514_10565920 | Not Available | 605 | Open in IMG/M |
| 3300032261|Ga0306920_103019432 | Not Available | 635 | Open in IMG/M |
| 3300032892|Ga0335081_10005265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 20471 | Open in IMG/M |
| 3300033289|Ga0310914_10181198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1874 | Open in IMG/M |
| 3300033290|Ga0318519_10964455 | Not Available | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.17% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.86% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.86% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066395_101954592 | 3300004633 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRRCGSELVRTSIRKAANPGAEAA* |
| Ga0066388_1007335082 | 3300005332 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA* |
| Ga0066388_1008039253 | 3300005332 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHSANPAEAA* |
| Ga0066388_1008420953 | 3300005332 | Tropical Forest Soil | MAYHGRRAVSAEMEDTIYACRSCGAELVRTSIRNAATSGAEAA* |
| Ga0066388_1009391832 | 3300005332 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHSADPAEAA* |
| Ga0008090_101700641 | 3300005363 | Tropical Rainforest Soil | MAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRHTTNPGAEAA* |
| Ga0070713_1004858802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYYGRRAVSAEMEDTVYACRSCGAELVRSSIRKAATSGAEAA* |
| Ga0066661_102947511 | 3300005554 | Soil | YHGRRPVSAEIEDTVYACRRCGAELVRTSMRARTNPGVEAA* |
| Ga0066903_1002460462 | 3300005764 | Tropical Forest Soil | MMPCPVCAGRMAYHARRAVSAEMEDTIYACRSCGAELIRTSMRKAAASGAEAA* |
| Ga0066903_1048165543 | 3300005764 | Tropical Forest Soil | PCPVCAGRMTYRGRSVSAEMEDTIYACRRCGAELVRTSMRDVASSGAEAA* |
| Ga0066903_1076718981 | 3300005764 | Tropical Forest Soil | GRRAVSAEMEDTVYACRNCGAELVRTSIRKAASSGAEAA* |
| Ga0066903_1076993592 | 3300005764 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSICKTANSGAEAA* |
| Ga0066903_1077721082 | 3300005764 | Tropical Forest Soil | MAYHGHRAVSAEMEDTVYACRSCGAELVRTSIRHAANPAEAA* |
| Ga0066903_1087409321 | 3300005764 | Tropical Forest Soil | VSAEMEDTIYACRRCGAEVVRTSMRNVASSGAEAA* |
| Ga0066652_1008877752 | 3300006046 | Soil | SAEMEDTVYACRRCGAELVRTSILKAGSPGAEAA* |
| Ga0075026_1002759542 | 3300006057 | Watersheds | MIYHGRRPVSAEMEDTVYACRRCGAELVRTSMRARTNPGVEAA* |
| Ga0075014_1009946302 | 3300006174 | Watersheds | MAYHGRRAVSAEVEDTVYACRRCGAELVRSSIRKATSTGAEAA* |
| Ga0079222_101922912 | 3300006755 | Agricultural Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRSSNRKAATSGAEAA* |
| Ga0079220_103118732 | 3300006806 | Agricultural Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRSSIRKAATSGAEAA* |
| Ga0126374_102665252 | 3300009792 | Tropical Forest Soil | MAYHGRRAVSPDMEDTVFACRSCGAELVRTSIRQAVKSGAEAA* |
| Ga0126380_112812111 | 3300010043 | Tropical Forest Soil | MTYRGRSVSAEMEDTIYACRRCGAEVVRTSMRNVASSGAEAA* |
| Ga0126384_100976533 | 3300010046 | Tropical Forest Soil | MAYHGRRAVSPEMEDTVFACRSCGAELVRTSIRQAVNPGAEAA* |
| Ga0126373_100330053 | 3300010048 | Tropical Forest Soil | MTYRGRSVSAEMEDTIYACRRCGAELVRTSMRDVASSGAEAA* |
| Ga0126373_103116172 | 3300010048 | Tropical Forest Soil | MAYHARRAVSAEMEDTIYACRSCGAELIRTSMRKAAASGAEAA* |
| Ga0126373_106369271 | 3300010048 | Tropical Forest Soil | MAYHGRRAVSAEIEDTVYACRSCGAELVRTSIRHSANPGVEAA* |
| Ga0134082_103303592 | 3300010303 | Grasslands Soil | MAYHGRRAVSAEMEDTVYACRRCGAELVRTSILKAGSPGAEAA* |
| Ga0126370_109223622 | 3300010358 | Tropical Forest Soil | MTYRGRSVSAEMEDTIYACRGCGAELVRTSMRDVASSGAEAA* |
| Ga0126376_112588661 | 3300010359 | Tropical Forest Soil | MAYRGRSVSAEMEDTTYACRRCGAEVVRTSMRNVASSGAEAA* |
| Ga0126372_113655412 | 3300010360 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHSA |
| Ga0126372_114881321 | 3300010360 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHPANPAEAA* |
| Ga0126378_103818051 | 3300010361 | Tropical Forest Soil | MAYHGRRAVSAEIEDTVYACRSCGAELVRTSIRPSANPGAEAA* |
| Ga0126378_106271001 | 3300010361 | Tropical Forest Soil | YHGRRAVSPEMEDTVFACRSCGAELVRTSIRQAVKSGAEAA* |
| Ga0126379_120181051 | 3300010366 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHSAN |
| Ga0126379_128805632 | 3300010366 | Tropical Forest Soil | MAYHGRRAVSPEMEDTVFACRSCGAELVRTSIRQAV |
| Ga0126381_1004083323 | 3300010376 | Tropical Forest Soil | MAYHGRCAVSAEMEDTVYACRSCGAELVRTSIPQAASGAEAA* |
| Ga0126381_1009558342 | 3300010376 | Tropical Forest Soil | MAYHGRRAVSADMEDTIYTCRQCGAELVRTSIRKATSPGAEAA* |
| Ga0126381_1014173251 | 3300010376 | Tropical Forest Soil | MSYHGRRAVSAEIEDTVYACRSCGAELVRTSIRHSANPGVEAA* |
| Ga0126381_1016793902 | 3300010376 | Tropical Forest Soil | RSVSAEMEDTIYACRRCGAEVVRTSMRNVASSGAEAA* |
| Ga0126383_104870861 | 3300010398 | Tropical Forest Soil | VSAEMEDTVFACRSCGAELVRTSIRHTANPGAEAA* |
| Ga0153922_11664891 | 3300012181 | Attine Ant Fungus Gardens | GRMAYHGRRAVSAEVEDTVYACRRCGAELVRSSIRKATSTGAEAA* |
| Ga0137376_115740452 | 3300012208 | Vadose Zone Soil | MIYHGRRPVSAEMEDTVYACRRCGAELVRTSMRTRTNPGVEAA* |
| Ga0137378_110062912 | 3300012210 | Vadose Zone Soil | RMIYHGRRPVSAEIEDTVYACRRCGAELVRTSMRTRTNSSIEAA* |
| Ga0137377_109643321 | 3300012211 | Vadose Zone Soil | MIYHGRRPVSAEMEDTVYACRRCGAELVRTSMRTRTNPGVEA |
| Ga0126369_104175583 | 3300012971 | Tropical Forest Soil | GRSVSAEMEDTIYACRRCGAELVRTSMRDVASSGAEAA* |
| Ga0126369_126077651 | 3300012971 | Tropical Forest Soil | DRRAVSAEMEDTVYACRKCGAELVRTSIRQTANPGAEAA* |
| Ga0126369_132348062 | 3300012971 | Tropical Forest Soil | MAYHARRAVSAEMEDTIYACRSCGAELIRTSMRKAAASSAEAA* |
| Ga0134078_100543961 | 3300014157 | Grasslands Soil | MAYHGRRAASAEMEDTVYACRRCGAELVRTSILKAGSPGAEAA* |
| Ga0182024_103320142 | 3300014501 | Permafrost | MVYHGRRIMSSDIEDTIYACRSCGAEVIRTSIRKTKGAEAA* |
| Ga0132257_1016438002 | 3300015373 | Arabidopsis Rhizosphere | MAFHGRRAVSAEMEDTVYACRKCGAELVRTSIRQSANPGAEAA* |
| Ga0182033_110050591 | 3300016319 | Soil | HGRRAVSAELEDTVYACRSCGAELVRTSIRQAANSGAEAA |
| Ga0182035_101700841 | 3300016341 | Soil | GRSVSAEMEDTIYACRGCGAELVRTSMRDVASSGAEAA |
| Ga0182032_101969341 | 3300016357 | Soil | MAYHACRAVSAEMEDTVYACRRCGSELVRTSIRKAANPGAEAA |
| Ga0182034_100677313 | 3300016371 | Soil | MAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTA |
| Ga0182034_118608482 | 3300016371 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQAA |
| Ga0182038_101317663 | 3300016445 | Soil | MAYHGRRPVSAELEDTVYACRSCGAELVRTSIRQAANPGAEAA |
| Ga0187824_102175372 | 3300017927 | Freshwater Sediment | MAYHGRRAVSAEMEDTIYACRSCGAELVRTSIRKAANHAGNRGAEAA |
| Ga0187814_100915123 | 3300017932 | Freshwater Sediment | RMSYEGRRAVSADLEDTVYACRRCGAELIRTSIRKIANPDAEAA |
| Ga0187821_100298073 | 3300017936 | Freshwater Sediment | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSICKAANPGAEAA |
| Ga0187821_100907442 | 3300017936 | Freshwater Sediment | CAGRMAYHGCRAVSAEMEDTIFTCRQCGAELIRTSMRSAANPGAEAA |
| Ga0187809_100261942 | 3300017937 | Freshwater Sediment | MSYEGRRAVSADLEDTVYACRRCGAELIRTSIRKIANPDAEAA |
| Ga0187809_101363691 | 3300017937 | Freshwater Sediment | MAYNGRRAVSAEMEDTVYACRSCGAELVRTSICKAANPGAEAA |
| Ga0187776_103152272 | 3300017966 | Tropical Peatland | MAYHGRRAVSTEMEDTVYACLSCGAELVRTSIRHAANPGAEAA |
| Ga0187780_108728101 | 3300017973 | Tropical Peatland | MAYHGRRAVSAEIEDTVYACRSCGAELIRSSIRQAAHSGAEAA |
| Ga0187777_107803802 | 3300017974 | Tropical Peatland | MAYHGRHAVSAELEDTVYACRSCGAELVRTSIRHNANPGAEAA |
| Ga0187766_100605972 | 3300018058 | Tropical Peatland | MAYYGRRAVSAEMEDTIYTCRQCGAELVRTSIRKAATSGAEAA |
| Ga0187784_101882872 | 3300018062 | Tropical Peatland | MVYQARSAVSSEMEDTIYACRRCGAELIRSSVCSVGSKKAEAA |
| Ga0187772_101446751 | 3300018085 | Tropical Peatland | GRMSYEGRRAVSADLEDTVYACRRCGAELIRTAMRKIASADAEAA |
| Ga0193751_10093555 | 3300019888 | Soil | MMYYGRRPVSAEIEDTVYACRRCGAELVRTSMRARTNPGVEAA |
| Ga0193751_10603483 | 3300019888 | Soil | MMYHGRRPVSAEIEDTVYACRRCGAELVRTSMRARTNPGVEAA |
| Ga0210403_100769092 | 3300020580 | Soil | MAYHGRRAASAEMEDTVYACRSCGAELVRSSIRKAATSGAEAA |
| Ga0210406_101163332 | 3300021168 | Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRSSIRKAATSGAEAA |
| Ga0187846_103283301 | 3300021476 | Biofilm | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRKAATSGAEAA |
| Ga0210402_120068052 | 3300021478 | Soil | MMYHGRRPVSAEMEDTVYACRRCGAELVRTSMRARTNPGVEAA |
| Ga0126371_102585862 | 3300021560 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRRCGSELVRTSIRKAANPGAEAA |
| Ga0126371_109428202 | 3300021560 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSMRTIRGPGAEAA |
| Ga0126371_114834452 | 3300021560 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHSADPAEAA |
| Ga0126371_121546502 | 3300021560 | Tropical Forest Soil | MAYHARRAVSAEMEDTIYACRSCGAELIRTSMRKAAASGAEAA |
| Ga0207699_112962211 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYHGRRAVSAELEDTIYACRKCGAELVRTSIRHSANPGTDAEAA |
| Ga0207802_10072312 | 3300026847 | Tropical Forest Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQAANPGAEAA |
| Ga0207822_10212061 | 3300026981 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRKTANSGAEAA |
| Ga0207766_10183911 | 3300027042 | Tropical Forest Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQATNPGAEAA |
| Ga0207761_10822821 | 3300027516 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELIRTSIRKAA |
| Ga0207862_11464872 | 3300027703 | Tropical Forest Soil | MAYHGRRAVSAEMEDTVYACRRCGAELVRTSIRQAANSGAEAA |
| Ga0209177_105065812 | 3300027775 | Agricultural Soil | CAGRMAYHGRRAVSAEMEDTVYACRSCGAELVRSSNRKAATSGAEAA |
| Ga0209074_104934651 | 3300027787 | Agricultural Soil | RAVSAEMEDTVYACRSCGAELVRSSNRKAATSGAEAA |
| Ga0209040_102629102 | 3300027824 | Bog Forest Soil | MAYHGRRAVSAEMEDTVYACRSCGAELIRTSICKAANPGAEAA |
| Ga0209698_112408682 | 3300027911 | Watersheds | MGYHGRRAVSAEMEDTVYACRNCGAELVRTSICKAANPGAEAA |
| Ga0170834_1101285741 | 3300031057 | Forest Soil | MAYQGRRAVSAEMEDTVYACRSCGAELVRSSIRKAATSGAEAA |
| Ga0170824_1269276452 | 3300031231 | Forest Soil | MIYHGRRPVSAEMEDTVYACRRCGAELVRTSMRARTNPGVEAA |
| Ga0302325_119461662 | 3300031234 | Palsa | HAVAYDMEDTVYACRRCGAEVIRTSMCKAKGAEAA |
| Ga0318516_104225182 | 3300031543 | Soil | MAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA |
| Ga0318516_107325052 | 3300031543 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQAANSGAEAA |
| Ga0318534_104463492 | 3300031544 | Soil | MAYHGRRAVSAEMEDTVYACRSCGAELVRTSIRHANPGAEAA |
| Ga0318534_106455612 | 3300031544 | Soil | MAYHGRRAVSAEMEDTVFACRSCGAELIRTSIRKTANSGAEAA |
| Ga0318538_104174981 | 3300031546 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRANSGAEAA |
| Ga0318571_104599941 | 3300031549 | Soil | MPCPVCAGRMAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA |
| Ga0318573_103837211 | 3300031564 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQTANSGAEAA |
| Ga0318515_104594092 | 3300031572 | Soil | MAYHRRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA |
| Ga0318561_104580822 | 3300031679 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSTRQAANPGAEAA |
| Ga0318574_107250901 | 3300031680 | Soil | YHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA |
| Ga0318494_101433551 | 3300031751 | Soil | MAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTAN |
| Ga0318537_102108782 | 3300031763 | Soil | AGRMAYHGRRAVSAELEDTVYACRSCGAELVRTSIRANSGAEAA |
| Ga0318535_105586261 | 3300031764 | Soil | PCPVCAGRMAYHGRRAVSTELEDTVYACRSCGAELVRTSIRQAANPGAEAA |
| Ga0318554_104741821 | 3300031765 | Soil | HGRRAVSAELEDTVYACRSCGAELVRTSIRQAANPGAEAA |
| Ga0318546_104473531 | 3300031771 | Soil | VCAGRMAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQAANSGAEAA |
| Ga0318565_101769202 | 3300031799 | Soil | LCAGRMAYHGRRAVSAEMEDTVFACRSCGAELVRTSIRKTANSGAEAA |
| Ga0307478_102022961 | 3300031823 | Hardwood Forest Soil | MAYHGRRAVSAEVEDTVYACRRCGAELVRSSIRKAANSGAEAA |
| Ga0310917_105579662 | 3300031833 | Soil | MAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQATNSGAEAA |
| Ga0318527_102874012 | 3300031859 | Soil | MAYHGRRAVSAEMEDTVFACRRCGAELVRTSICKTANSGAEAA |
| Ga0306923_114364352 | 3300031910 | Soil | MAYHARRAVSAEMEDTVYACRRCGSELVRTSIRKAANPGAEAA |
| Ga0318549_103580261 | 3300032041 | Soil | RMAYHGRRAVSAELEDTVYACRSCGAELVRTSIRQAANPGAEAA |
| Ga0318514_105659201 | 3300032066 | Soil | YHGRRAVSAELEDTVYACRSCGAELVRTSIRANSGAEAA |
| Ga0306920_1030194321 | 3300032261 | Soil | MAYHARRAVSAEMEDTVYACRRCGSELVRTSIRKAANSGAEAA |
| Ga0335081_1000526513 | 3300032892 | Soil | MAYHGRRAVSAETEDTVYACRSCGAELVRTSIRQTATPGAEAA |
| Ga0310914_101811981 | 3300033289 | Soil | AGRMTYRGRSVSAEMEDTIYACRGCGAELVRTSMRDVASSGAEAA |
| Ga0318519_109644551 | 3300033290 | Soil | YRGRSVSAEMEDTIYACRGCGAELVRTSMRDVASSGAEAA |
| ⦗Top⦘ |