Basic Information | |
---|---|
Family ID | F079044 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 36 residues |
Representative Sequence | MRRRHIARKAVKTAIIAKSAQHLARRAEKHLGKHQ |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.66 % |
% of genes near scaffold ends (potentially truncated) | 12.07 % |
% of genes from short scaffolds (< 2000 bps) | 76.72 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.793 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.552 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.897 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.069 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF01027 | Bax1-I | 15.52 |
PF01297 | ZnuA | 3.45 |
PF00196 | GerE | 3.45 |
PF13520 | AA_permease_2 | 3.45 |
PF04972 | BON | 2.59 |
PF00005 | ABC_tran | 1.72 |
PF00924 | MS_channel | 1.72 |
PF07167 | PhaC_N | 0.86 |
PF04199 | Cyclase | 0.86 |
PF12802 | MarR_2 | 0.86 |
PF00903 | Glyoxalase | 0.86 |
PF03729 | DUF308 | 0.86 |
PF01566 | Nramp | 0.86 |
PF13006 | Nterm_IS4 | 0.86 |
PF11239 | DUF3040 | 0.86 |
PF01638 | HxlR | 0.86 |
PF03706 | LPG_synthase_TM | 0.86 |
PF07676 | PD40 | 0.86 |
PF13424 | TPR_12 | 0.86 |
PF12681 | Glyoxalase_2 | 0.86 |
PF09363 | XFP_C | 0.86 |
PF02467 | Whib | 0.86 |
PF13185 | GAF_2 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 1.72 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.86 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.86 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.86 |
COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.86 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.66 % |
Unclassified | root | N/A | 35.34 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10313971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 975 | Open in IMG/M |
3300001867|JGI12627J18819_10104899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
3300005538|Ga0070731_10074059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2259 | Open in IMG/M |
3300005563|Ga0068855_100552341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
3300005563|Ga0068855_100604097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1183 | Open in IMG/M |
3300005610|Ga0070763_10888517 | Not Available | 530 | Open in IMG/M |
3300005616|Ga0068852_102394094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora lupini → Micromonospora lupini str. Lupac 08 | 549 | Open in IMG/M |
3300005842|Ga0068858_101265406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora lupini → Micromonospora lupini str. Lupac 08 | 726 | Open in IMG/M |
3300006028|Ga0070717_10386521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1255 | Open in IMG/M |
3300006028|Ga0070717_10800230 | Not Available | 857 | Open in IMG/M |
3300006052|Ga0075029_101143694 | Not Available | 542 | Open in IMG/M |
3300006102|Ga0075015_100267699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
3300006162|Ga0075030_101570824 | Not Available | 515 | Open in IMG/M |
3300006175|Ga0070712_100027007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3829 | Open in IMG/M |
3300006804|Ga0079221_11791715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300009098|Ga0105245_10241878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1750 | Open in IMG/M |
3300009522|Ga0116218_1053293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1834 | Open in IMG/M |
3300009523|Ga0116221_1549270 | Not Available | 507 | Open in IMG/M |
3300009525|Ga0116220_10141096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300009698|Ga0116216_10684574 | Not Available | 616 | Open in IMG/M |
3300009700|Ga0116217_10083839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2208 | Open in IMG/M |
3300009764|Ga0116134_1144357 | Not Available | 842 | Open in IMG/M |
3300010339|Ga0074046_10002871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14676 | Open in IMG/M |
3300010339|Ga0074046_10507643 | Not Available | 719 | Open in IMG/M |
3300010339|Ga0074046_10661901 | Not Available | 615 | Open in IMG/M |
3300010339|Ga0074046_10812329 | Not Available | 546 | Open in IMG/M |
3300010341|Ga0074045_10090282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2131 | Open in IMG/M |
3300010341|Ga0074045_10394527 | Not Available | 898 | Open in IMG/M |
3300010379|Ga0136449_102080619 | Not Available | 834 | Open in IMG/M |
3300010396|Ga0134126_10480850 | Not Available | 1434 | Open in IMG/M |
3300010867|Ga0126347_1051991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
3300010869|Ga0126359_1708718 | Not Available | 843 | Open in IMG/M |
3300010876|Ga0126361_10226725 | Not Available | 613 | Open in IMG/M |
3300010877|Ga0126356_10044022 | Not Available | 742 | Open in IMG/M |
3300012201|Ga0137365_10898502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300012210|Ga0137378_10567662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1044 | Open in IMG/M |
3300012357|Ga0137384_10755334 | Not Available | 788 | Open in IMG/M |
3300012359|Ga0137385_11236843 | Not Available | 609 | Open in IMG/M |
3300012360|Ga0137375_10010918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10749 | Open in IMG/M |
3300012923|Ga0137359_10363136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1287 | Open in IMG/M |
3300012957|Ga0164303_11215857 | Not Available | 552 | Open in IMG/M |
3300017821|Ga0187812_1009598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3352 | Open in IMG/M |
3300017821|Ga0187812_1012200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2984 | Open in IMG/M |
3300017821|Ga0187812_1030991 | Not Available | 1829 | Open in IMG/M |
3300017924|Ga0187820_1007458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2582 | Open in IMG/M |
3300017924|Ga0187820_1176996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300017926|Ga0187807_1079604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1024 | Open in IMG/M |
3300017928|Ga0187806_1036005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1477 | Open in IMG/M |
3300017932|Ga0187814_10024878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2239 | Open in IMG/M |
3300017933|Ga0187801_10159496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300017934|Ga0187803_10266518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
3300017942|Ga0187808_10129783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300017942|Ga0187808_10422979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300017942|Ga0187808_10490167 | Not Available | 569 | Open in IMG/M |
3300017943|Ga0187819_10825653 | Not Available | 520 | Open in IMG/M |
3300017948|Ga0187847_10406040 | Not Available | 749 | Open in IMG/M |
3300017959|Ga0187779_10527129 | Not Available | 784 | Open in IMG/M |
3300017972|Ga0187781_10096055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2054 | Open in IMG/M |
3300017975|Ga0187782_10120665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1938 | Open in IMG/M |
3300017994|Ga0187822_10155958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300018046|Ga0187851_10085800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1978 | Open in IMG/M |
3300018085|Ga0187772_10389167 | Not Available | 969 | Open in IMG/M |
3300021405|Ga0210387_11112627 | Not Available | 689 | Open in IMG/M |
3300021439|Ga0213879_10200214 | Not Available | 594 | Open in IMG/M |
3300021861|Ga0213853_11109712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300025898|Ga0207692_10263768 | Not Available | 1036 | Open in IMG/M |
3300025910|Ga0207684_10037287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4125 | Open in IMG/M |
3300025916|Ga0207663_10323740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 1159 | Open in IMG/M |
3300025916|Ga0207663_10421715 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300027696|Ga0208696_1061447 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1294 | Open in IMG/M |
3300027783|Ga0209448_10186410 | Not Available | 689 | Open in IMG/M |
3300027812|Ga0209656_10000318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32511 | Open in IMG/M |
3300027812|Ga0209656_10048703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2407 | Open in IMG/M |
3300027812|Ga0209656_10060739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2092 | Open in IMG/M |
3300027812|Ga0209656_10103449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1492 | Open in IMG/M |
3300027812|Ga0209656_10130816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300027812|Ga0209656_10522730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300027824|Ga0209040_10353805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
3300027825|Ga0209039_10310789 | Not Available | 619 | Open in IMG/M |
3300027911|Ga0209698_10632412 | Not Available | 820 | Open in IMG/M |
3300028381|Ga0268264_11802291 | Not Available | 622 | Open in IMG/M |
3300028800|Ga0265338_10204214 | Not Available | 1488 | Open in IMG/M |
3300030706|Ga0310039_10163994 | Not Available | 892 | Open in IMG/M |
3300031234|Ga0302325_10228692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3141 | Open in IMG/M |
3300031708|Ga0310686_105305316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5558 | Open in IMG/M |
3300031708|Ga0310686_106238409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 900 | Open in IMG/M |
3300031708|Ga0310686_117306736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
3300031942|Ga0310916_10033265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3806 | Open in IMG/M |
3300031962|Ga0307479_10024316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5738 | Open in IMG/M |
3300032160|Ga0311301_12870571 | Not Available | 523 | Open in IMG/M |
3300032180|Ga0307471_101683125 | Not Available | 789 | Open in IMG/M |
3300032770|Ga0335085_10035483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6889 | Open in IMG/M |
3300032770|Ga0335085_10122996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3307 | Open in IMG/M |
3300032770|Ga0335085_10309948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1866 | Open in IMG/M |
3300032770|Ga0335085_10313028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1855 | Open in IMG/M |
3300032770|Ga0335085_10729657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
3300032770|Ga0335085_10885737 | Not Available | 974 | Open in IMG/M |
3300032770|Ga0335085_11114798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 844 | Open in IMG/M |
3300032783|Ga0335079_10339802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1631 | Open in IMG/M |
3300032783|Ga0335079_10557595 | Not Available | 1214 | Open in IMG/M |
3300032783|Ga0335079_11901474 | Not Available | 576 | Open in IMG/M |
3300032783|Ga0335079_12222796 | Not Available | 523 | Open in IMG/M |
3300032828|Ga0335080_11200721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300032828|Ga0335080_11517127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300032829|Ga0335070_10140457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2470 | Open in IMG/M |
3300032895|Ga0335074_10051075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5691 | Open in IMG/M |
3300032895|Ga0335074_10195669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2474 | Open in IMG/M |
3300032895|Ga0335074_10252557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 2073 | Open in IMG/M |
3300032895|Ga0335074_10366100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1590 | Open in IMG/M |
3300032898|Ga0335072_10731186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
3300032898|Ga0335072_11319300 | Not Available | 630 | Open in IMG/M |
3300032954|Ga0335083_10660381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
3300033134|Ga0335073_10038786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6467 | Open in IMG/M |
3300033134|Ga0335073_10071162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 4573 | Open in IMG/M |
3300033134|Ga0335073_10288965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1974 | Open in IMG/M |
3300033134|Ga0335073_10538570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 12.93% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.03% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.17% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 5.17% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_103139711 | 3300001593 | Forest Soil | MRRRRIARQAVKTAIIAKAAHRLGHRAAKHLTKH* |
JGI12627J18819_101048991 | 3300001867 | Forest Soil | VSTMRRRHIARKAVKTAIIAKTAQHLAHRVERRQSKRK* |
Ga0070731_100740592 | 3300005538 | Surface Soil | MRRRRIARKAVKTAIIAKAAQRLGRRAVKHLVKH* |
Ga0068855_1005523411 | 3300005563 | Corn Rhizosphere | MRRRRIARKAVKTAIIAKAAHRLGRRAAKHLTKH* |
Ga0068855_1006040972 | 3300005563 | Corn Rhizosphere | MRRRRIARKAVKTAIIAKAAHRLGRRAVKHLAKH* |
Ga0070763_108885172 | 3300005610 | Soil | MKRRPVIRKAVKTALITKAAERLGRRAVKQLKKH* |
Ga0068852_1023940941 | 3300005616 | Corn Rhizosphere | MRRRRIALKVVKTAIIAKAAHRLGRRAVKDLAKH* |
Ga0068858_1012654062 | 3300005842 | Switchgrass Rhizosphere | MRRRRIARKAVKTAIIAKAAHRLGRRAAKHLAKH* |
Ga0070717_103865212 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRRIARKAVKTAIIAKSARHLARRAEKHLRKHQ* |
Ga0070717_108002302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRRIARKAVKTAIIAKSARHLARRAEKHLRKHQ* |
Ga0075029_1011436942 | 3300006052 | Watersheds | MRRRNIARKAVKTAIIAKTAQRLAHRAEKHLGKHK* |
Ga0075015_1002676992 | 3300006102 | Watersheds | MRRRHIARKAVKTAIIAKSAQHLARRAEKHLHKHQ* |
Ga0075030_1015708242 | 3300006162 | Watersheds | MRRRNIARKAVKTAIIAKSAQHLARRAEKHLHKHQ* |
Ga0070712_1000270071 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRHIARKAIKTAIIAKSARHLARRAERHLGKHQ* |
Ga0079221_117917152 | 3300006804 | Agricultural Soil | MRRRRIARKAVKAAIIAKSARHLARRAEKHLRKHQ* |
Ga0105245_102418782 | 3300009098 | Miscanthus Rhizosphere | MRRRRIARKAVKTAIIAKAAHRLGRRAVKDLAKH* |
Ga0116218_10532933 | 3300009522 | Peatlands Soil | MRRRHIARKAVKTAIIAKSAQRLAHRAEKHLGKHK* |
Ga0116221_15492702 | 3300009523 | Peatlands Soil | MRRRHIARKAVKTAIIAKTAQRLAHRAEKHLGKHK* |
Ga0116220_101410963 | 3300009525 | Peatlands Soil | MRRRHIARKAVKTAIIAKSAQRLGRRAEKHLRKHQ* |
Ga0116216_106845742 | 3300009698 | Peatlands Soil | MRRRHIARKAVKTAIIAKSAQRLGRRAEKHLGKHH* |
Ga0116217_100838392 | 3300009700 | Peatlands Soil | MRRRNIARKAVKTAIIAKSAQRLAHRAEKHLGKHK* |
Ga0116134_11443572 | 3300009764 | Peatland | MRRRRIARKAVKTAIIAKAAQRLGRRAVKHLPKH* |
Ga0074046_100028715 | 3300010339 | Bog Forest Soil | MRRRQIARKAIKTGIIVKSAQHLARRAERHLSKHK* |
Ga0074046_105076432 | 3300010339 | Bog Forest Soil | MRRRRIARKAVKTAIIAKSAQHLARRAEKHLHKHQ* |
Ga0074046_106619012 | 3300010339 | Bog Forest Soil | MQRRHIARKAIKTGIIVKSVQHLARRAERHLGKHQ* |
Ga0074046_108123292 | 3300010339 | Bog Forest Soil | MRRRHIARKAIKTGIIVKSAQHLARRAEKHLHKHQ* |
Ga0074045_100902823 | 3300010341 | Bog Forest Soil | MRRRRIVRRAVKTAIIAKSAQRLGRRVEKHLGKHH* |
Ga0074045_103945272 | 3300010341 | Bog Forest Soil | MRRRHIARKAVKTAIIVKAAQRLGRRAEKHLSRH* |
Ga0136449_1020806192 | 3300010379 | Peatlands Soil | MRQRHIARKAVKTAIIVKAPQRLGRRAEKHRGRH* |
Ga0134126_104808503 | 3300010396 | Terrestrial Soil | MRRRPIVRKAVKTALIAKAAQRLGRRAEQHLRKH* |
Ga0126347_10519912 | 3300010867 | Boreal Forest Soil | MRRRRIARKAVKTAIIAKAAHRLGRRAVKHLTKN* |
Ga0126359_17087181 | 3300010869 | Boreal Forest Soil | MRRRRIARKAVKTAIIAKAARRLGSRAVKHMTKH* |
Ga0126361_102267253 | 3300010876 | Boreal Forest Soil | MRRRRIARKAVKTAIIAKAAQRLGRRAVKHLSKH* |
Ga0126356_100440221 | 3300010877 | Boreal Forest Soil | MRRRPIIRKAVKSAIIVKAAKHLATRTEKHLSKKH |
Ga0137365_108985022 | 3300012201 | Vadose Zone Soil | MRRRHIARKAVKTAIIAKTARHLAHRVERRQSKRK* |
Ga0137378_105676624 | 3300012210 | Vadose Zone Soil | MRRRRIARKAVKTAIIAKAARHLARRAEKHLGKHQ* |
Ga0137384_107553342 | 3300012357 | Vadose Zone Soil | MRRRPIIRKAVKTALIAKAALRLGRRAEQHLKKH* |
Ga0137385_112368432 | 3300012359 | Vadose Zone Soil | MRRRRIARTAVKTAIIAKAARHLARRAEKHLGKHQ* |
Ga0137375_100109183 | 3300012360 | Vadose Zone Soil | MRRRPIIRKAVKTALIAKAAQRLGRRAEEHLKRH* |
Ga0137359_103631363 | 3300012923 | Vadose Zone Soil | MMRRRPIIRKAVKTALIAKAALRLGRRAEQHLKKH* |
Ga0164303_112158571 | 3300012957 | Soil | QRRRRIARKAIKTAIIAKSARHLARRAEKHLRKHQ* |
Ga0187812_10095981 | 3300017821 | Freshwater Sediment | MRRRRILRKAVKTALIAKSARRLGQRAEKHLHKNR |
Ga0187812_10122004 | 3300017821 | Freshwater Sediment | MRRRRIARKAIKTAIIAKSAQHLARRVEKHLSKHQ |
Ga0187812_10309913 | 3300017821 | Freshwater Sediment | MRRRTISRKAVNTALIVKAAQRLGHRAEKHLRKHSPHQAR |
Ga0187820_10074583 | 3300017924 | Freshwater Sediment | MRRRRIARRAVKTAIIAKSAQHLARRAEKHLGKHQ |
Ga0187820_11769962 | 3300017924 | Freshwater Sediment | MRRRNIARKAVKTAIIAKTAQRLAHRAEKHLHKHQ |
Ga0187807_10796042 | 3300017926 | Freshwater Sediment | MRRRRIARKAVKTAIIVKSARHLARRAEKHLAKHV |
Ga0187806_10360052 | 3300017928 | Freshwater Sediment | MRRRTISRKAVNTALIVKAAQRLGRRAEKHLRKHSPHQAR |
Ga0187814_100248781 | 3300017932 | Freshwater Sediment | ETASDRKGTVMRRRAIPRKAVNTALIVKAAQRLGRRAEKHLRKHSPHQAR |
Ga0187801_101594961 | 3300017933 | Freshwater Sediment | TSTMRRRHIARKAVKTAIIAKSAQHLARRVEKHLSKHQ |
Ga0187803_102665182 | 3300017934 | Freshwater Sediment | MRRRRIARRAVKTAIIAKSAQHLARRVENHLSKNQ |
Ga0187808_101297832 | 3300017942 | Freshwater Sediment | MRRRHIARKAIKTAIIAKSAQHLARRVEKHLSKHQ |
Ga0187808_104229792 | 3300017942 | Freshwater Sediment | MRRRHIARKAVKTAIIAKSAQHLARRAQKHLGKHH |
Ga0187808_104901672 | 3300017942 | Freshwater Sediment | MRRRTITREAVNTALIVKAAQRLGRRAEKHLRKHSPHQAR |
Ga0187819_108256532 | 3300017943 | Freshwater Sediment | MRRRAIPRKAVNTALIVKAAQRLGRRAEKHLRKHSPHQAR |
Ga0187847_104060401 | 3300017948 | Peatland | MRRRHIARKAVKTAIIAKSAQHLAHRAAKHLGKQR |
Ga0187779_105271292 | 3300017959 | Tropical Peatland | MRRRTITREAVNTALIVKAAQRLGRRAEKHLRKHSPQQAR |
Ga0187781_100960552 | 3300017972 | Tropical Peatland | MRRRTIARKAVNTALIVKAAQRLGRRAEQHLRKHSPRQAR |
Ga0187782_101206651 | 3300017975 | Tropical Peatland | MHRHIIARKAVNTALIVKAAQRLGRRAEKHLRKHPPHQARTPE |
Ga0187822_101559582 | 3300017994 | Freshwater Sediment | MRRRHIARKAIKTAIIAKSAQHLARRAEKHLSKHQ |
Ga0187851_100858003 | 3300018046 | Peatland | MRRRHIARKAVKTALIAKSAQHLAHRFTKHLGKRQ |
Ga0187772_103891673 | 3300018085 | Tropical Peatland | MRRRPIARKAVNTALIVQAAQRLGRRAEKHLRKRSPDQAG |
Ga0210387_111126271 | 3300021405 | Soil | MRRRPIIRKAVKSAIIVKAAKHLATRTEKHLSKKLAK |
Ga0213879_102002142 | 3300021439 | Bulk Soil | MPHSNRAMRRRSIARKGVRTALIVKAAERLGHRVEKHLKKH |
Ga0213853_111097121 | 3300021861 | Watersheds | MRRRHIARKAVKTAIIAKTAQHLAHRVERRPSKRK |
Ga0207692_102637682 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRHIARKAIKTAIIAKSARHLARRAERHLGKHQ |
Ga0207684_100372875 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRRIARKAIKTAIIAKSVRQLARRAEKHLGKHK |
Ga0207663_103237401 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HRKGNSTMRRRHIARKAIKTAIIAKSARHLARRAERHLGKHQ |
Ga0207663_104217152 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRHIARKAIKTAIIATSARHLARRAERHLGKHQ |
Ga0208696_10614472 | 3300027696 | Peatlands Soil | MRRRHIARKAVKTAIIAKSAQRLAHRAEKHLGKHK |
Ga0209448_101864102 | 3300027783 | Bog Forest Soil | MRRRRIARKAVKTAIIAKSAQRLAQRAEKHLGKHK |
Ga0209656_1000031823 | 3300027812 | Bog Forest Soil | MRRRHIARKAVKTAIIAKSAQHLARRAEKHLHKHQ |
Ga0209656_100487033 | 3300027812 | Bog Forest Soil | MRRRRIARKAVKTAIIVKSARRLASRAEKHLAKHV |
Ga0209656_100607393 | 3300027812 | Bog Forest Soil | MRRRHIARKAIKTGIIVKSAQHLARRAEKHLHKHQ |
Ga0209656_101034492 | 3300027812 | Bog Forest Soil | MRRRQIARKAIKTGIIVKSAQHLARRAERHLSKHK |
Ga0209656_101308163 | 3300027812 | Bog Forest Soil | MRRRHIARKAIKTAIIAKSAQHLARRAEKHLRKHQ |
Ga0209656_105227302 | 3300027812 | Bog Forest Soil | MRRRHIARKAVKTAIIVKSAHRLAHRAEKHLGKHQ |
Ga0209040_103538052 | 3300027824 | Bog Forest Soil | MQRRHIARKAIKTGIIVKSVQHLARRAERHLGKHQ |
Ga0209039_103107891 | 3300027825 | Bog Forest Soil | EKETRIMRRRHIARKAIKTGIIVKSAQHLARRAEKHLHKHQ |
Ga0209698_106324121 | 3300027911 | Watersheds | MRRRNIARKAVKTAIIAKSAQHLARRAEKHLHKHQ |
Ga0268264_118022912 | 3300028381 | Switchgrass Rhizosphere | TGIMRRRRIARKAVKTAIIAKAAHRLGRRAAKHLTKH |
Ga0265338_102042142 | 3300028800 | Rhizosphere | MRRRPIVRKAVKTALIAKSAQHLARRVTKHLGKRH |
Ga0310039_101639942 | 3300030706 | Peatlands Soil | MRRRHIARKAVKTAIIAKSAQRLGRRAEKHLGKHH |
Ga0302325_102286921 | 3300031234 | Palsa | KGTRIMRRRRIARQAVKTAIIAKAAHRLGHRAAKHLTKH |
Ga0310686_1053053162 | 3300031708 | Soil | MRRRPVIRKTVKTALITKAAERLGRRAEKHLEKQIKKH |
Ga0310686_1062384092 | 3300031708 | Soil | MERRPIIRKTVKTAIIAKAAERLARRAVKQVVKKH |
Ga0310686_1173067361 | 3300031708 | Soil | MRRRPILRRAVKTALIAKAAQRLGRRAEQHLSKRVDNHLGKH |
Ga0310916_100332654 | 3300031942 | Soil | IRQRGTSIMRRRPIIRKAVKTAIIAKAAQRLGRRAEQHLRRH |
Ga0307479_100243163 | 3300031962 | Hardwood Forest Soil | MRRRRMVRKAVKAAIISKTAHRLARRAEKHLSDRITHR |
Ga0311301_128705711 | 3300032160 | Peatlands Soil | MRRRNIARKAVKTAIIAKTAQRLAHRAEKHLGKHK |
Ga0307471_1016831252 | 3300032180 | Hardwood Forest Soil | MRRRRIARKAVKTAFIATSARQIARRAEKHLRKHKFA |
Ga0335085_100354839 | 3300032770 | Soil | MRRRRIARKAVKTAIIAKAARHLARRAEKHLPKHQ |
Ga0335085_101229963 | 3300032770 | Soil | MRRRRIARKAVKTAIIAKSAQHIARRAEKHLHKHQ |
Ga0335085_103099483 | 3300032770 | Soil | MRRRHIARKAVKTAIIAKTAQHLAHRVETRQSKRK |
Ga0335085_103130282 | 3300032770 | Soil | MRRRHIARKAIKTAIIAKSAQHLARRVEKHLSKNQ |
Ga0335085_107296572 | 3300032770 | Soil | MRRRHIARKAVKTAIIAKSAQHLARRAERHLGKHQ |
Ga0335085_108857371 | 3300032770 | Soil | MRRRHIARKAVKTAIIAKTAQHLAHRVESRHSKRK |
Ga0335085_111147982 | 3300032770 | Soil | MRRRRIARKAVKTAIIAKTARHLARRAEKHLPKHQ |
Ga0335079_103398023 | 3300032783 | Soil | MRRRHIARKAVKTAIIAKSAQHLARRAEKHLSKHR |
Ga0335079_105575951 | 3300032783 | Soil | MHRRIIARKAVNTALIVKAVQRLGRRAEKHLGRPSPHQAR |
Ga0335079_119014741 | 3300032783 | Soil | MRRRRIARKAVKTAIIVKSARHLARRAEKHVAKHV |
Ga0335079_122227962 | 3300032783 | Soil | MRRRPIVRKAVKTALIAKSAQHLARRVTKHLGKRR |
Ga0335080_112007212 | 3300032828 | Soil | MRRRRIARKAVKTAIIAKSAQHLARRAEKHLRKHQ |
Ga0335080_115171272 | 3300032828 | Soil | MRRRHIARKAVKTAIIAKSAQHLARRAEKHLGKHQ |
Ga0335070_101404574 | 3300032829 | Soil | EKEISTMRRRRIARKAVKTAIIAKSAQHIARRAEKHLHKHQ |
Ga0335074_100510753 | 3300032895 | Soil | MRRRRIARKAVKTAIIAKSAQHLARRAERHLGKQQ |
Ga0335074_101956695 | 3300032895 | Soil | MRRRPIVRKAVKTAIIVKAAQRLGRRAERHLTKHAEHLGRH |
Ga0335074_102525573 | 3300032895 | Soil | MRRRRVIRKAVKTAIIAKSARRLAHRAEKHVAKHV |
Ga0335074_103661003 | 3300032895 | Soil | MRRRRIARKAVKTAIIVKSAQHLARRAEKHLAKHV |
Ga0335072_107311861 | 3300032898 | Soil | MRRRPIIRKAVKTALIAKSAQHLARRVTKHLGKRH |
Ga0335072_113193001 | 3300032898 | Soil | MRRRRIARKAVKTAIIAKAARHLARRAEKHLRKHQ |
Ga0335083_106603812 | 3300032954 | Soil | KGTDTMRRRRIARKAVKTAIIVKSARRLASRAEKHLAKHV |
Ga0335073_100387864 | 3300033134 | Soil | MRRRPIVRKAVKTALIAKSAQHLARRMTKHLGKRH |
Ga0335073_100711623 | 3300033134 | Soil | MRRRRILRKAVKTAIIAKSARRLARRAEKHLAKHV |
Ga0335073_102889653 | 3300033134 | Soil | MRRRRIARKAVKTAIIAKTAQHLAHRVESRHSKRK |
Ga0335073_105385702 | 3300033134 | Soil | MRRRNIARKAVKTAIIAKSARHLARRAEKHLRRHQ |
⦗Top⦘ |