NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079011

Metagenome / Metatranscriptome Family F079011

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079011
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 40 residues
Representative Sequence RAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT
Number of Associated Samples 101
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.10 %
% of genes near scaffold ends (potentially truncated) 78.45 %
% of genes from short scaffolds (< 2000 bps) 84.48 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.897 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.793 % of family members)
Environment Ontology (ENVO) Unclassified
(31.897 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.966 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.40%    β-sheet: 0.00%    Coil/Unstructured: 80.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00180Iso_dh 31.90
PF08450SGL 12.07
PF03600CitMHS 10.34
PF02687FtsX 3.45
PF00694Aconitase_C 2.59
PF02567PhzC-PhzF 1.72
PF07366SnoaL 1.72
PF07007LprI 0.86
PF14559TPR_19 0.86
PF12680SnoaL_2 0.86
PF13751DDE_Tnp_1_6 0.86
PF13744HTH_37 0.86
PF01243Putative_PNPOx 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 12.07
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 12.07
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 1.72
COG3755Uncharacterized conserved protein YecT, DUF1311 familyFunction unknown [S] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.90 %
UnclassifiedrootN/A18.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02FU6LINot Available522Open in IMG/M
2170459010|GIO7OMY01BS199Not Available502Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10107109Not Available588Open in IMG/M
3300000955|JGI1027J12803_101396029Not Available679Open in IMG/M
3300000955|JGI1027J12803_102056512All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300001139|JGI10220J13317_10652034All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300004114|Ga0062593_100020531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3476Open in IMG/M
3300005186|Ga0066676_11135611All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005293|Ga0065715_10152238All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300005293|Ga0065715_10282859All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005332|Ga0066388_104281411All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium727Open in IMG/M
3300005343|Ga0070687_100155432All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300005353|Ga0070669_101467397All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria592Open in IMG/M
3300005440|Ga0070705_101695926All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005471|Ga0070698_101583477All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005540|Ga0066697_10197562All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300005553|Ga0066695_10769704All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005559|Ga0066700_10714403All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300005561|Ga0066699_10615391All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300005566|Ga0066693_10041411All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1505Open in IMG/M
3300005566|Ga0066693_10048929All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300005614|Ga0068856_101245655Not Available760Open in IMG/M
3300005713|Ga0066905_100096588All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300005764|Ga0066903_106035290All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005764|Ga0066903_106507196All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300005983|Ga0081540_1051905All Organisms → cellular organisms → Bacteria2024Open in IMG/M
3300006028|Ga0070717_10618820All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300006057|Ga0075026_100256231All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300006175|Ga0070712_101198305All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300006358|Ga0068871_100509843All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300006800|Ga0066660_10501251All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300006804|Ga0079221_10342999All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300006893|Ga0073928_10429349All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia961Open in IMG/M
3300006904|Ga0075424_100196490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2142Open in IMG/M
3300006904|Ga0075424_100449066All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300009012|Ga0066710_100319310All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2283Open in IMG/M
3300009012|Ga0066710_100936297All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300009100|Ga0075418_10144375All Organisms → cellular organisms → Bacteria2532Open in IMG/M
3300009146|Ga0105091_10073278All Organisms → cellular organisms → Bacteria → Proteobacteria1544Open in IMG/M
3300009147|Ga0114129_10772421All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300010047|Ga0126382_10261902All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1274Open in IMG/M
3300010048|Ga0126373_10449743All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300010320|Ga0134109_10261038All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia656Open in IMG/M
3300010321|Ga0134067_10080104All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300010335|Ga0134063_10167329All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1025Open in IMG/M
3300010359|Ga0126376_10715928Not Available965Open in IMG/M
3300010362|Ga0126377_11485010Not Available751Open in IMG/M
3300011998|Ga0120114_1067567All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300012198|Ga0137364_10013963All Organisms → cellular organisms → Bacteria4717Open in IMG/M
3300012198|Ga0137364_11042192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia617Open in IMG/M
3300012198|Ga0137364_11427400Not Available512Open in IMG/M
3300012199|Ga0137383_11366946All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300012202|Ga0137363_11366303All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium598Open in IMG/M
3300012202|Ga0137363_11690436All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012205|Ga0137362_11286595All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300012208|Ga0137376_10050337All Organisms → cellular organisms → Bacteria3405Open in IMG/M
3300012285|Ga0137370_10159695All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1307Open in IMG/M
3300012285|Ga0137370_10533937All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium720Open in IMG/M
3300012359|Ga0137385_10132872All Organisms → cellular organisms → Bacteria2195Open in IMG/M
3300012362|Ga0137361_10889377All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012929|Ga0137404_10452651All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1139Open in IMG/M
3300012948|Ga0126375_10596303All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300012960|Ga0164301_10631533All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012971|Ga0126369_12510044All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300012975|Ga0134110_10204050All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia830Open in IMG/M
3300012984|Ga0164309_11965615All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia501Open in IMG/M
3300014745|Ga0157377_10384210All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300014968|Ga0157379_11054696Not Available777Open in IMG/M
3300015373|Ga0132257_102294223Not Available699Open in IMG/M
3300015374|Ga0132255_101739095All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300016319|Ga0182033_10035287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3243Open in IMG/M
3300016319|Ga0182033_11030775All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300016341|Ga0182035_10562685All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium981Open in IMG/M
3300016357|Ga0182032_10045260All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2814Open in IMG/M
3300016387|Ga0182040_10065373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2333Open in IMG/M
3300018000|Ga0184604_10325777All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018066|Ga0184617_1239487Not Available543Open in IMG/M
3300018081|Ga0184625_10374777All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300018081|Ga0184625_10670814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium500Open in IMG/M
3300018431|Ga0066655_10193113All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300018482|Ga0066669_10077660All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2222Open in IMG/M
3300019789|Ga0137408_1194907All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300019887|Ga0193729_1052782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1647Open in IMG/M
3300020004|Ga0193755_1167169All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300020004|Ga0193755_1199823Not Available571Open in IMG/M
3300020012|Ga0193732_1019648All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300020022|Ga0193733_1068335Not Available999Open in IMG/M
3300020140|Ga0179590_1152467Not Available632Open in IMG/M
3300025625|Ga0208219_1010471All Organisms → cellular organisms → Bacteria → Proteobacteria3015Open in IMG/M
3300025915|Ga0207693_10040667Not Available3662Open in IMG/M
3300025916|Ga0207663_10269510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1261Open in IMG/M
3300025931|Ga0207644_10915150Not Available735Open in IMG/M
3300025933|Ga0207706_10122250All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300025933|Ga0207706_10895541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium750Open in IMG/M
3300025961|Ga0207712_10046924All Organisms → cellular organisms → Bacteria2997Open in IMG/M
3300025986|Ga0207658_11477492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium622Open in IMG/M
3300026067|Ga0207678_10906943Not Available779Open in IMG/M
3300026330|Ga0209473_1009494All Organisms → cellular organisms → Bacteria4867Open in IMG/M
3300027018|Ga0208475_1009424Not Available958Open in IMG/M
3300028536|Ga0137415_11466951All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium507Open in IMG/M
3300028587|Ga0247828_10397902All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300028814|Ga0307302_10200516All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300028881|Ga0307277_10301538All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300030844|Ga0075377_11630986All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300031446|Ga0170820_11340063All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031719|Ga0306917_10962212Not Available667Open in IMG/M
3300031777|Ga0318543_10409046All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300031879|Ga0306919_10266054All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1294Open in IMG/M
3300031945|Ga0310913_10966785All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia598Open in IMG/M
3300031946|Ga0310910_10767738All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium760Open in IMG/M
3300031954|Ga0306926_11768477All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300032180|Ga0307471_100151122All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300032180|Ga0307471_101809704Not Available762Open in IMG/M
3300032205|Ga0307472_100633184Not Available950Open in IMG/M
3300032421|Ga0310812_10554508All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300033289|Ga0310914_10436061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1186Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.31%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.86%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.86%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.86%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.86%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.86%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_030564502065487018SoilRAYMFGDEFRRYIEDEVMKKQPHRDAKPMGVFPIGQSVS
F62_049133202170459010Grass SoilKAFWKDRAYMFGDEFRRHIEDDLMKRQPHPDAKPMGAFAIGQSAN
AF_2010_repII_A001DRAFT_1010710923300000793Forest SoilDRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFPIGQSVS*
JGI1027J12803_10139602913300000955SoilAFWKDRAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIAPKDGMN*
JGI1027J12803_10205651213300000955SoilKERAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT*
JGI10220J13317_1065203423300001139SoilWKDRGYMFGEEFRHYVEDDLMERTPHPDAKPMGAFPISQRSE*
Ga0062593_10002053113300004114SoilRAYMFGDEFRRHIEDDLMKREPHPDAKPMGAFRIGTGFAPRN*
Ga0066676_1113561113300005186SoilMFLSNRAYMFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE*
Ga0065715_1015223833300005293Miscanthus RhizosphereKERAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE*
Ga0065715_1028285913300005293Miscanthus RhizosphereKAFWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSTEQESAR*
Ga0066388_10428141123300005332Tropical Forest SoilFWKDRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFSIGQRSE*
Ga0070687_10015543213300005343Switchgrass RhizosphereRAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIGRPSE*
Ga0070669_10146739713300005353Switchgrass RhizosphereWADRGYMFGAKFRDYIETDLMQRTPHPGAKPLGAFNIGQQTS*
Ga0070705_10169592623300005440Corn, Switchgrass And Miscanthus RhizosphereRAYMFGDEFRRHIENDLMKRKPHPDAKPMGAFSIGQSTQ*
Ga0070698_10158347723300005471Corn, Switchgrass And Miscanthus RhizosphereFWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSAEQESAR*
Ga0066697_1019756223300005540SoilMFGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE*
Ga0066695_1076970413300005553SoilMFGEEFRHYVEDDLMKRTLHPDAKPMGAFPIGQRSE*
Ga0066700_1071440313300005559SoilDFFGEEFRRHVEDDLMKRTSHPDAKPMGAFSIGRPSE*
Ga0066699_1061539123300005561SoilMFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE*
Ga0066693_1004141113300005566SoilERGYLFGEEFRRHVENGLMKREPHPDAKPMGAFSIGREG*
Ga0066693_1004892933300005566SoilMFGEEFRHYVEDDLMKRTPYPDAKPMGAFPIGRRSE*
Ga0068856_10124565523300005614Corn RhizosphereYLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN*
Ga0066905_10009658813300005713Tropical Forest SoilRAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAEVRNNELA*
Ga0066903_10603529013300005764Tropical Forest SoilPGGKDFWKERGYMFGDEFRQYIEDDLIKREPHPGAKPLGAFRIG*
Ga0066903_10650719623300005764Tropical Forest SoilFWKERGYMFGDEFRRYIEDDLLKREPHPGAKPLGAFSIGQGPD*
Ga0081540_105190523300005983Tabebuia Heterophylla RhizosphereMFGDEFRRYIEEDVMKKKPHPDAKPMGAFSIGQRND*
Ga0070717_1061882023300006028Corn, Switchgrass And Miscanthus RhizosphereGYMFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRRAE*
Ga0075026_10025623113300006057WatershedsGKAFWKDRAYMFGDEFRRYIEDDLIKRQPHPDAKPMGVFSISQRSE*
Ga0070712_10119830523300006175Corn, Switchgrass And Miscanthus RhizosphereGKAFWKERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPVK*
Ga0068871_10050984323300006358Miscanthus RhizosphereMFGEEFRRYVENDLMKRGPHPDAKPLGAFPIGRHAE*
Ga0066660_1050125113300006800SoilFWKERGYLFGEEFRRHVEDDLMKREPHPDARPMGAFSICRGAE*
Ga0079221_1034299913300006804Agricultural SoilLFGEDFRQYIENDLMIRPPHPDAKPLGAFTIGPRTG*
Ga0073928_1042934923300006893Iron-Sulfur Acid SpringAYLFDDEFRRHVEDDLMKRTPHPDAKPLGAFSIGKKSDE*
Ga0075424_10019649033300006904Populus RhizosphereMFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRRAE*
Ga0075424_10044906613300006904Populus RhizosphereWKDRAYMFGDEFRRHIENDLMKREPHPDAKPMGAFSIGQSAT*
Ga0066710_10031931023300009012Grasslands SoilVTDFFGEEFRRHVESNLMKRTPRPDAKPMGAFSIDRQGD
Ga0066710_10093629713300009012Grasslands SoilREVTDSFGEEFRRYVENDLMKRTLHPDAKPMGAFSIGRPE
Ga0075418_1014437533300009100Populus RhizosphereMFGDEFRRYIEDEVMKKKPHPDAKPMGVFPIGQPAE*
Ga0105091_1007327813300009146Freshwater SedimentRGYLFGDEFRSYVENDVMMRKPHPRAKPMGAFPIGDASC*
Ga0114129_1077242123300009147Populus RhizosphereMFGDEFRRYIEDEVMNKKPHPDAKPMGVFPIGQPAE*
Ga0126382_1026190213300010047Tropical Forest SoilMFGDEFRRYIDDDLIKREPHPDAKPMGVFSIGQRPE*
Ga0126373_1044974333300010048Tropical Forest SoilDRAYMFGDEFRRYIETDLMNREPHPDAKPMGAFSIGQSAT*
Ga0134109_1026103813300010320Grasslands SoilMCGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE*
Ga0134067_1008010423300010321Grasslands SoilMFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGRRSE*
Ga0134063_1016732923300010335Grasslands SoilMFGEEFRHYVEDDLMKRTPHPDAKPMGVFRIGQQAE*
Ga0126376_1071592823300010359Tropical Forest SoilAFWKDRAYMFGDEFRRYIENDVMKKKPHPDAKPMGVFSIAESTK*
Ga0126377_1148501023300010362Tropical Forest SoilSDWAYMFGVAFRRYIEAEVMKKKPPPDAKPMGAIPIGQSVS*
Ga0120114_106756713300011998PermafrostWKERGYLFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGRRAE*
Ga0137364_1001396323300012198Vadose Zone SoilMFGEELRRHVEDDLMKRGPHPDARPMGAFSIGQRVEEVASDRC*
Ga0137364_1104219223300012198Vadose Zone SoilYLFGEEFRRHVENGLMKREPHPDAKPMGAFSIGREG*
Ga0137364_1142740013300012198Vadose Zone SoilRAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE*
Ga0137383_1136694623300012199Vadose Zone SoilAYMFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE*
Ga0137363_1136630323300012202Vadose Zone SoilMFGEEFRRYVENDLMKREPHPDAKPLGAFPIGQRSE*
Ga0137363_1169043613300012202Vadose Zone SoilMFGDEFRRYVENDLMKREPHPDAKAMGAFPIGHR*
Ga0137362_1128659513300012205Vadose Zone SoilFWKERGYMFGDEFRRYVESDLMKREPHPDTKPMGAFPIGQSAT*
Ga0137376_1005033723300012208Vadose Zone SoilMFGDAFQRYIETDLMKREPHPDAKPKGAFSIGQRAE*
Ga0137370_1015969513300012285Vadose Zone SoilVLFGEEFRRYVENDLMKRTPHPDAKPMGAFGIGRPSE*
Ga0137370_1053393723300012285Vadose Zone SoilFGDEFRCYIESDLMKRKPHPDAKPMGAFSLDRSAE*
Ga0137385_1013287223300012359Vadose Zone SoilMFGDAFQRYIETDLMKREPYPDAKPKGAFSIGQRAE*
Ga0137361_1088937723300012362Vadose Zone SoilFGEEFRRYVENDLMKREPHPDAKPMGAFSIGQSAT*
Ga0137404_1045265113300012929Vadose Zone SoilWEIARGYMFGEEFRRYVEDDLMKRAPYPDAKPMGAFSIGRPSE*
Ga0126375_1059630333300012948Tropical Forest SoilAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAEVRNNELA*
Ga0164301_1063153313300012960SoilGGKAFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFPIGQPAE*
Ga0126369_1251004413300012971Tropical Forest SoilLFGEEFRRYVEDDLMKRKPHPDAKPLGAFSIGKETS*
Ga0134110_1020405023300012975Grasslands SoilMFGEEFRRYLENDLMKREPHPDAKPFGAFPIGRRAE*
Ga0164309_1196561513300012984SoilMFGEEFRRYVENDLMKREPHPDAKPLGAFPIGRHAE*
Ga0157377_1038421023300014745Miscanthus RhizosphereMFGEEFRRHVEDDLMKRTPHSDAKPMGAFSIGRRAE*
Ga0157379_1105469623300014968Switchgrass RhizosphereAFWKDRAYMFGDEFRQHIESDLMKREPHADAKPMGAFAIGQPVQ*
Ga0132257_10229422323300015373Arabidopsis RhizosphereYLFGEEFRQYIENDLMKREPHPDAKPLGAFSISQAQSN*
Ga0132255_10173909513300015374Arabidopsis RhizosphereKDRAYMFGDEFRRYIETDLMKREPHPDAKPMGAFSLGRSAE*
Ga0182033_1003528743300016319SoilWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE
Ga0182033_1103077513300016319SoilAFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFPIGQSAT
Ga0182035_1056268523300016341SoilYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE
Ga0182032_1004526013300016357SoilDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE
Ga0182040_1006537333300016387SoilFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE
Ga0184604_1032577733300018000Groundwater SedimentFGEEFRRYIENDLMIRPPHPDAKPLGAFTIGPRTE
Ga0184617_123948723300018066Groundwater SedimentAFWKDRAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIGRPAE
Ga0184625_1037477713300018081Groundwater SedimentRAYMFGDEFRRYIENDLMKREPHPDAKPMGAFSIGQSAT
Ga0184625_1067081423300018081Groundwater SedimentLFGKEFGDYVENDVMKREPHPNARPMGAFSIGPDRT
Ga0066655_1019311323300018431Grasslands SoilMFGEEFRRYVENDLMKREPHPDAKPFGAFPIGRRAE
Ga0066669_1007766043300018482Grasslands SoilMFGEEFRHYVEDDLMKRTLHPDAKPMGAFPIGQRSE
Ga0137408_119490713300019789Vadose Zone SoilDRGYMFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE
Ga0193729_105278213300019887SoilYLFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGRRAE
Ga0193755_116716923300020004SoilLFGEEFRRHVEDDLMKRTPHPDAKPMGAFSIGSPAN
Ga0193755_119982313300020004SoilMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAQAQSN
Ga0193732_101964833300020012SoilKDRAYMFGDEFRRYVESDLMKREPHPDAKPMGAFPIGHR
Ga0193733_106833523300020022SoilKERSYLFGEEFRRYIENDLMIRPPHPGAKPLGAFTIGPHTE
Ga0179590_115246723300020140Vadose Zone SoilKERAYMFGDEFRRYIENDVMKREPHPDAKPMGAFSIAQVQKN
Ga0208219_101047133300025625Arctic Peat SoilGYLFGQDFRNHFENDLMKRTPHRAAKPMGAFSIGQKPEGQAAATKT
Ga0207693_1004066713300025915Corn, Switchgrass And Miscanthus RhizosphereAYMFGDEFRCYIETDLMKREPHPDAKPMGAFAIGQPVK
Ga0207663_1026951033300025916Corn, Switchgrass And Miscanthus RhizosphereMFGEEFRHYVEDDLMKRTPHPDAKPMGAFPIGQRSE
Ga0207644_1091515013300025931Switchgrass RhizosphereYLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN
Ga0207706_1012225013300025933Corn RhizosphereAYMFGDEFRRHIESDLMKRQPHPDAKPMGAFSLGQSTEQESAR
Ga0207706_1089554123300025933Corn RhizosphereSYLFGEEFRRYVEDDLMKRTPHPEAKPMGAFSIGTPAR
Ga0207712_1004692413300025961Switchgrass RhizosphereAFWKDRAYMFGDEFRRHIENDLMKRQPHPDAKPMGAFSLGQSTEQESAR
Ga0207658_1147749233300025986Switchgrass RhizosphereWTERGYLFGEDFRRHVENDLMKRKPHAKAKPMGAFSIGEGGS
Ga0207678_1090694313300026067Corn RhizosphereWKERNYLFGEEFRRYIENDLMKREPHPDAKPLGAFSISQAQSN
Ga0209473_100949423300026330SoilMFGEEFRHYVEDDLMKRTPYPDAKPMGAFPIGRRSE
Ga0208475_100942423300027018SoilRGYLFGEEFRRYIENDLMKRTPHPDAKPMGAFSIAEVRNN
Ga0137415_1146695113300028536Vadose Zone SoilFGDEFRRYIEEDLIKREPHPDAKPIGAFSIGQRAE
Ga0247828_1039790223300028587SoilRAYMFGDEFRRHIEDDLMKREPHPDARPMGAFSIGPGAE
Ga0307302_1020051613300028814SoilERAYMIGDEFRQYIETDLMKREPHPDAKPMGAFSIGQSAT
Ga0307277_1030153823300028881SoilFGDEFRQYIETDLMKREPHPDAKPMGAFSIGQSAT
Ga0075377_1163098613300030844SoilYMFGDEFRRYVESDLMKREPHPDAKPMGAFSIGQSAR
Ga0170820_1134006313300031446Forest SoilRAYMFGDEFRRYVESDLMKREPHPDAKPMGAFSIGQSAT
Ga0306917_1096221223300031719SoilERAGYLVGEEFRRHVEDDLMKRTLHPDAKPFGVFSIAGIK
Ga0318543_1040904623300031777SoilGGKAFWKDRAYMFGDEFRRYIEDDVMKKKPHPDAKPMGVFSIGQRSE
Ga0306919_1026605423300031879SoilKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE
Ga0310913_1096678523300031945SoilFGEEFRRHVEGDLMKRTPHPDAKPLGAFSIGRSDQ
Ga0310910_1076773823300031946SoilWKDRAYMFGDEFRRYIEDDVMKKKPHPDAKPMGVFSIGQRSE
Ga0306926_1176847713300031954SoilGKAFWKDRAYMFGDEFRRYIEDEVMKKKPHPDAKPMGVFSIAGVTD
Ga0307471_10015112233300032180Hardwood Forest SoilERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPVK
Ga0307471_10180970423300032180Hardwood Forest SoilKERAYMFGDEFRRYIETDLMKREPHPDAKPMGAFAIGQPAK
Ga0307472_10063318423300032205Hardwood Forest SoilERAYMFGDEFRRYIENDLMKREPHPDARPMGAFSIGRPAE
Ga0310812_1055450823300032421SoilMFGDEFRRYIENDVMKKEPHPDAKPMGAFSIGQSAT
Ga0310914_1043606113300033289SoilGKVFWKDRAYMFGDEFRRYIEDEVMKKQPHPDAKPMGVFSIGQRSE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.