Basic Information | |
---|---|
Family ID | F078844 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 40 residues |
Representative Sequence | MGKKDAKVRMSLQTLRVLEAFLENPTEQLSGADVHQRCRIA |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 26.72 % |
% of genes near scaffold ends (potentially truncated) | 98.28 % |
% of genes from short scaffolds (< 2000 bps) | 93.10 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.724 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.517 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.966 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.931 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF02472 | ExbD | 18.10 |
PF00583 | Acetyltransf_1 | 4.31 |
PF01464 | SLT | 4.31 |
PF00072 | Response_reg | 3.45 |
PF04972 | BON | 1.72 |
PF11295 | DUF3096 | 1.72 |
PF04389 | Peptidase_M28 | 1.72 |
PF00248 | Aldo_ket_red | 1.72 |
PF01545 | Cation_efflux | 1.72 |
PF00106 | adh_short | 0.86 |
PF14321 | DUF4382 | 0.86 |
PF00989 | PAS | 0.86 |
PF13662 | Toprim_4 | 0.86 |
PF00188 | CAP | 0.86 |
PF04984 | Phage_sheath_1 | 0.86 |
PF01177 | Asp_Glu_race | 0.86 |
PF01641 | SelR | 0.86 |
PF01739 | CheR | 0.86 |
PF13602 | ADH_zinc_N_2 | 0.86 |
PF02424 | ApbE | 0.86 |
PF00383 | dCMP_cyt_deam_1 | 0.86 |
PF00892 | EamA | 0.86 |
PF03060 | NMO | 0.86 |
PF06127 | Mpo1-like | 0.86 |
PF07715 | Plug | 0.86 |
PF02826 | 2-Hacid_dh_C | 0.86 |
PF02368 | Big_2 | 0.86 |
PF08327 | AHSA1 | 0.86 |
PF00378 | ECH_1 | 0.86 |
PF05163 | DinB | 0.86 |
PF00005 | ABC_tran | 0.86 |
PF01850 | PIN | 0.86 |
PF02798 | GST_N | 0.86 |
PF00436 | SSB | 0.86 |
PF01381 | HTH_3 | 0.86 |
PF02824 | TGS | 0.86 |
PF10282 | Lactonase | 0.86 |
PF01625 | PMSR | 0.86 |
PF02518 | HATPase_c | 0.86 |
PF12840 | HTH_20 | 0.86 |
PF13417 | GST_N_3 | 0.86 |
PF00487 | FA_desaturase | 0.86 |
PF08240 | ADH_N | 0.86 |
PF13601 | HTH_34 | 0.86 |
PF08734 | GYD | 0.86 |
PF09926 | DUF2158 | 0.86 |
PF00733 | Asn_synthase | 0.86 |
PF00326 | Peptidase_S9 | 0.86 |
PF02653 | BPD_transp_2 | 0.86 |
PF13411 | MerR_1 | 0.86 |
PF13781 | DoxX_3 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 18.10 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.72 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.72 |
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.72 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.72 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.86 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.86 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.86 |
COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.86 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.86 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.86 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.86 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.86 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.86 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.86 |
COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.72 % |
Unclassified | root | N/A | 23.28 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101546096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
3300004082|Ga0062384_100404040 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300004635|Ga0062388_102598753 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005535|Ga0070684_100745137 | Not Available | 914 | Open in IMG/M |
3300005538|Ga0070731_10341054 | Not Available | 995 | Open in IMG/M |
3300005538|Ga0070731_10993771 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005563|Ga0068855_100504399 | Not Available | 1314 | Open in IMG/M |
3300005610|Ga0070763_10108945 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300005993|Ga0080027_10356640 | Not Available | 586 | Open in IMG/M |
3300006041|Ga0075023_100262050 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300006050|Ga0075028_100103933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
3300006050|Ga0075028_100429647 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300006086|Ga0075019_11128109 | Not Available | 510 | Open in IMG/M |
3300006162|Ga0075030_100998607 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300006162|Ga0075030_101097875 | Not Available | 626 | Open in IMG/M |
3300006237|Ga0097621_102212081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 526 | Open in IMG/M |
3300009633|Ga0116129_1001238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14342 | Open in IMG/M |
3300009787|Ga0116226_11111113 | Not Available | 754 | Open in IMG/M |
3300009826|Ga0123355_12067100 | Not Available | 525 | Open in IMG/M |
3300010341|Ga0074045_10392900 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300010343|Ga0074044_10237655 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300010343|Ga0074044_11009351 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010358|Ga0126370_10536477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
3300010371|Ga0134125_12578066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
3300010375|Ga0105239_11201739 | Not Available | 874 | Open in IMG/M |
3300010880|Ga0126350_12252303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 635 | Open in IMG/M |
3300012361|Ga0137360_10811573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 805 | Open in IMG/M |
3300012582|Ga0137358_10720133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300012685|Ga0137397_10337154 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300012918|Ga0137396_10632139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
3300012922|Ga0137394_10341423 | Not Available | 1278 | Open in IMG/M |
3300012924|Ga0137413_10032743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2871 | Open in IMG/M |
3300012927|Ga0137416_10908679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
3300012929|Ga0137404_12014691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300014657|Ga0181522_10542703 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300014658|Ga0181519_10556346 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300014969|Ga0157376_11544279 | Not Available | 697 | Open in IMG/M |
3300015245|Ga0137409_10293074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 1432 | Open in IMG/M |
3300017959|Ga0187779_10789324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300018044|Ga0187890_10484641 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300018085|Ga0187772_11435976 | Not Available | 513 | Open in IMG/M |
3300020580|Ga0210403_10060558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3032 | Open in IMG/M |
3300020581|Ga0210399_10395473 | Not Available | 1153 | Open in IMG/M |
3300021180|Ga0210396_11475845 | Not Available | 560 | Open in IMG/M |
3300021181|Ga0210388_10978969 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300021361|Ga0213872_10314878 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300021362|Ga0213882_10343996 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300021404|Ga0210389_10943012 | Not Available | 671 | Open in IMG/M |
3300021406|Ga0210386_11175518 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300021420|Ga0210394_10392290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
3300021433|Ga0210391_11248575 | Not Available | 574 | Open in IMG/M |
3300021559|Ga0210409_10270378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
3300023101|Ga0224557_1300205 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300023270|Ga0247784_1002402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4825 | Open in IMG/M |
3300025463|Ga0208193_1009177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3147 | Open in IMG/M |
3300025905|Ga0207685_10474411 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025910|Ga0207684_10884787 | Not Available | 751 | Open in IMG/M |
3300025914|Ga0207671_10756531 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300025914|Ga0207671_11451717 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300025928|Ga0207700_10423778 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300025928|Ga0207700_10803048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300025929|Ga0207664_10366715 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300026215|Ga0209849_1089602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300026555|Ga0179593_1118423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3173 | Open in IMG/M |
3300027591|Ga0209733_1106112 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300027692|Ga0209530_1084827 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300027869|Ga0209579_10478507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 676 | Open in IMG/M |
3300027879|Ga0209169_10420944 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300027884|Ga0209275_10289238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
3300027908|Ga0209006_10669991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 851 | Open in IMG/M |
3300027911|Ga0209698_10904964 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300028789|Ga0302232_10087021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
3300028798|Ga0302222_10083416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
3300028877|Ga0302235_10290980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 707 | Open in IMG/M |
3300029915|Ga0311358_10580836 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300029944|Ga0311352_11047491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → unclassified Holophagaceae → Holophagaceae bacterium | 626 | Open in IMG/M |
3300029951|Ga0311371_12439630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 535 | Open in IMG/M |
3300029987|Ga0311334_10681996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 839 | Open in IMG/M |
3300029990|Ga0311336_10923109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300029999|Ga0311339_11257040 | Not Available | 674 | Open in IMG/M |
3300030046|Ga0302305_1249508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. 12-68-7 | 626 | Open in IMG/M |
3300030399|Ga0311353_10799074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
3300030503|Ga0311370_11173357 | Not Available | 835 | Open in IMG/M |
3300030503|Ga0311370_12072012 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300030520|Ga0311372_12129303 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300030730|Ga0307482_1305733 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → unclassified Spirochaetaceae → Spirochaetaceae bacterium | 513 | Open in IMG/M |
3300030862|Ga0265753_1082329 | Not Available | 625 | Open in IMG/M |
3300030943|Ga0311366_10540831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1014 | Open in IMG/M |
3300031057|Ga0170834_104046845 | Not Available | 555 | Open in IMG/M |
3300031231|Ga0170824_110864688 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300031233|Ga0302307_10458699 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300031233|Ga0302307_10721551 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031234|Ga0302325_13088710 | Not Available | 535 | Open in IMG/M |
3300031236|Ga0302324_100734591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1387 | Open in IMG/M |
3300031236|Ga0302324_101074229 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300031239|Ga0265328_10180783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300031524|Ga0302320_10165512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3280 | Open in IMG/M |
3300031525|Ga0302326_11741978 | Not Available | 819 | Open in IMG/M |
3300031668|Ga0318542_10492175 | Not Available | 637 | Open in IMG/M |
3300031672|Ga0307373_10362672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300031680|Ga0318574_10286290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 956 | Open in IMG/M |
3300031680|Ga0318574_10478876 | Not Available | 729 | Open in IMG/M |
3300031680|Ga0318574_10883972 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031708|Ga0310686_102169013 | Not Available | 782 | Open in IMG/M |
3300031763|Ga0318537_10022937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2184 | Open in IMG/M |
3300031918|Ga0311367_10448565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
3300031942|Ga0310916_10638659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 903 | Open in IMG/M |
3300031947|Ga0310909_11191141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 616 | Open in IMG/M |
3300031962|Ga0307479_11888980 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300032008|Ga0318562_10072150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1927 | Open in IMG/M |
3300032044|Ga0318558_10377806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 704 | Open in IMG/M |
3300032782|Ga0335082_10881425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 758 | Open in IMG/M |
3300033158|Ga0335077_10440321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1391 | Open in IMG/M |
3300033824|Ga0334840_112218 | Not Available | 744 | Open in IMG/M |
3300034163|Ga0370515_0093579 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300034282|Ga0370492_0141974 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 14.66% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.62% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.59% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.59% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.72% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.86% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.86% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.86% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.86% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.86% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.86% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1015460962 | 3300002245 | Forest Soil | MGKKERDVRMSLQTLKVLEAFLENPTEQRSGADVHQRCGI |
Ga0062384_1004040401 | 3300004082 | Bog Forest Soil | MGKQVGNVRMSLQTLRVLEIFLENPAERLSGAEVHQRCGIASGTLY |
Ga0062388_1025987532 | 3300004635 | Bog Forest Soil | MGKKDTNVRMSLQTLRVLEVFLENPTEQFAGAQVHQRCGI |
Ga0070684_1007451371 | 3300005535 | Corn Rhizosphere | MGKQERSVRMSLQTLRTLEAFLESPTDELSGSDVQKRSGL |
Ga0070731_103410543 | 3300005538 | Surface Soil | MGKDRDVRISLQTLRVLEAFLESPTDQLSGADVQK |
Ga0070731_109937711 | 3300005538 | Surface Soil | MGRKDTRVRMSLQTLKVLEAFLENPTERLSGAEVHQRCGIASG |
Ga0068855_1005043993 | 3300005563 | Corn Rhizosphere | MGKQERSVRMSLQTLRTLEAFLESPTDELSGSDVQKRSGLASG |
Ga0070763_101089454 | 3300005610 | Soil | MGQKDREVRMSLQTLRVLETFLDNLTEQLAGAEVHQRCG |
Ga0080027_103566401 | 3300005993 | Prmafrost Soil | MRMSLQTMRVLELFLESPMEQLSGADVHQRCGIASGTLYP |
Ga0075023_1002620503 | 3300006041 | Watersheds | MGKQDRDVRMSLQTLRVLEAFLEDPTGELAGADVQKL |
Ga0075028_1001039333 | 3300006050 | Watersheds | MGKPDREVRISLQTLRVLEVFLDNPTDPLSGADVQKRSRLASGTLYP |
Ga0075028_1004296472 | 3300006050 | Watersheds | MSLQTLKVLEAFLENPTDQLSGAEVHQRCHLASGTLYPILL |
Ga0075019_111281091 | 3300006086 | Watersheds | MGSPERNVRMSLQTLKVLEVFLENPAAQLSGADVHQ |
Ga0075030_1009986072 | 3300006162 | Watersheds | MGKKDAKVRMSLQTLRVLEAFLENPTEQLSGADVHQRCRIA |
Ga0075030_1010978752 | 3300006162 | Watersheds | MSLQTLHVLEAFLENPSDQLSGADVHQRCGIASGTLYP |
Ga0097621_1022120811 | 3300006237 | Miscanthus Rhizosphere | MGKPDRQVRMSLQTLRVLEIFLENPTEQLSGAEVHQRCGI |
Ga0116129_100123814 | 3300009633 | Peatland | MGKKDGNVRMSLQTLRVLEVFLENPTERFAGAEVHQRCGMAWLIG* |
Ga0116226_111111132 | 3300009787 | Host-Associated | MGKREQKVRMSLQTLRVLETFLENPTEQLSGADVHQRCGI |
Ga0123355_120671002 | 3300009826 | Termite Gut | MGKKERDVRISLQTLHVLEAFLENPGEQLAGADVQRRTGLA |
Ga0074045_103929002 | 3300010341 | Bog Forest Soil | MGKKDTTVRMSLQTLRVLEAFLENPSEQLAGAEVHQRCGIASGTL |
Ga0074044_102376551 | 3300010343 | Bog Forest Soil | MGKEERNVRMSLQTLRVLEAFLESPTASLSGADVHQQCGI |
Ga0074044_110093512 | 3300010343 | Bog Forest Soil | MGKEDRNVRMSLQTLKVLEAFLESPMSQLSGADIHQGN |
Ga0126370_105364773 | 3300010358 | Tropical Forest Soil | MGKRDRDVRMSLQTLRVLDAFLENPSDELAGADVQKRSGL |
Ga0134125_125780661 | 3300010371 | Terrestrial Soil | MSLQTLKVLDAFLSDPTDELSGADVQKRSGIASGTLYPI |
Ga0105239_112017391 | 3300010375 | Corn Rhizosphere | MSLQTLRTLEAFLESPTDELSGSDVQKRSGLASGTLYPI |
Ga0126350_122523031 | 3300010880 | Boreal Forest Soil | MSLQTLRALESFLENPTDELSGADVQKRSGLASGTLYPILL |
Ga0137360_108115732 | 3300012361 | Vadose Zone Soil | MGKRDREVRMSLQTLRVLEAFLEDPTDELSGADVYKRSGIAS |
Ga0137358_107201332 | 3300012582 | Vadose Zone Soil | MGKQSRDVRMSLQTLRVLEAFLENPTNELSGADVHKRSSLASGTL |
Ga0137397_103371541 | 3300012685 | Vadose Zone Soil | MGKKDTNVRMSLQTLRVLEAFLENPTVQLAGAEVHQ |
Ga0137396_106321391 | 3300012918 | Vadose Zone Soil | MSLQTLRVLEAFLENPTDELSGADVQKRGGLASGTLYPILL |
Ga0137394_103414231 | 3300012922 | Vadose Zone Soil | MSLQTLRVLEAFLEDPTDQLSGADVHQRCGIASGTLYPIL |
Ga0137413_100327431 | 3300012924 | Vadose Zone Soil | MGKKDANVRMSLQTLRVLEVFLENPTERLAGADVHQRCGIASGTL |
Ga0137416_109086792 | 3300012927 | Vadose Zone Soil | MSLQTLRVLEAFLENPSVQLAGAEVHQRCGIASGTLYPILLR |
Ga0137404_120146912 | 3300012929 | Vadose Zone Soil | MGKQSRDVRMSLQTLRVLEAFLENPTNELSGADVHK |
Ga0181522_105427032 | 3300014657 | Bog | MGKQDRDVRMSLQTLKVLEAFLEEPMTQLSGADIHQRSRIASGTLY |
Ga0181519_105563462 | 3300014658 | Bog | MSLQTLQVLEAFLENPTVQLAGADVHQRCGIASGTLYP |
Ga0157376_115442792 | 3300014969 | Miscanthus Rhizosphere | MGKQERSVRMSLQTLRTLEAFLESPTDELSGSDVQKRS |
Ga0137409_102930743 | 3300015245 | Vadose Zone Soil | MGKQDRDVRMSLQTLRTLESFLENPTDELSGADVQKRSGLA |
Ga0187779_107893243 | 3300017959 | Tropical Peatland | MSFQTLKVLEAFLENPGEELSGADVHKRSGIASGTL |
Ga0187890_104846411 | 3300018044 | Peatland | MGRKDTKVRMSLQTLRVLEAFLENPTLQLAGADVHQR |
Ga0187772_114359762 | 3300018085 | Tropical Peatland | MGRTDRPVRMSLQSLRVLEAFLESPAEELSGADVHK |
Ga0210403_100605582 | 3300020580 | Soil | MGKKDGNVRMSLQTLRVLEVFLENPTERFAGAEVHQRCGIASGTLYPI |
Ga0210399_103954731 | 3300020581 | Soil | MRMSLQTLRVLEVFLENPTEQLSGAEVHQRCGLASGTL |
Ga0210396_114758451 | 3300021180 | Soil | MGKESRDVRMSLQTLKVLEAFLENPADQLSGAEVRQRCGLASGTLY |
Ga0210388_109789692 | 3300021181 | Soil | MGRKNRDVRISLQTLRVLEAFLDHPAESLSGSDVQ |
Ga0213872_103148781 | 3300021361 | Rhizosphere | MGKMDRDVRMSLQTLRVLDAFLASPAEELAGADVHKRSGLASGARY |
Ga0213882_103439962 | 3300021362 | Exposed Rock | MGKPDRPVRMSLQTLRVLDAFLENPAHELAGADVQ |
Ga0210389_109430121 | 3300021404 | Soil | MGKESRDVRMSLQTLKVLEAFLENPADQLSGAEVR |
Ga0210386_111755182 | 3300021406 | Soil | MGKKETSVRMSLQTLRVLEAFLENPTEQLAGAEVHQR |
Ga0210394_103922904 | 3300021420 | Soil | MGKKDRDVRISLQTLKVLEVFLENPTEQLSGADVHLHCG |
Ga0210391_112485751 | 3300021433 | Soil | MGKKDAGVRMSLQTLRVLEVFLENPTEQLAGADLHQ |
Ga0210409_102703783 | 3300021559 | Soil | MGRQDRDVRLSLQTLKVLEAFLENPTDQLSGADVQKRS |
Ga0224557_13002051 | 3300023101 | Soil | MGKKDTDVRMSLQTLRVLEAFLENPTAQLAGAEVHQRCG |
Ga0247784_10024027 | 3300023270 | Plant Litter | MVKKDRDVRMSLQTMRVLEAFLENPTDELAGADVQKRSGLASGT |
Ga0208193_10091774 | 3300025463 | Peatland | MGKKDGNVRMSLQTLRVLEVFLENPTERFAGAEVHQRCGMAWLIG |
Ga0207685_104744111 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKRDRDVRMSLQTLRVLDAFLENPADELAGADVQKRSGLASGTLY |
Ga0207684_108847871 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKDRNVRMSLQTLHVLEAFLENPTDELSGADVQKRSNLA |
Ga0207671_107565312 | 3300025914 | Corn Rhizosphere | MGKQERSVRMSLQTLRTLEAFLESPTDELSGSDVQK |
Ga0207671_114517172 | 3300025914 | Corn Rhizosphere | MGKQERSVRMSLQTLRTLEAFLESPTDELSGSDVQKRSG |
Ga0207700_104237781 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKRDRDVRMSLQTLRVLDAFLENPADELAGADVQK |
Ga0207700_108030481 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNPDRQVRMSLQTLRVLEIFLENPTQQLSGAEVHQRCG |
Ga0207664_103667153 | 3300025929 | Agricultural Soil | MGKGPRDVRMSLQTLKVLDAFLSEPTDELSGADVQ |
Ga0209849_10896021 | 3300026215 | Soil | MGKKDTNVRMSLQTLRVLEAFLENPTVQLAGAEVHQRCGI |
Ga0179593_11184231 | 3300026555 | Vadose Zone Soil | SLQTLRVLEAFLENPTDQLAGADVHKRSGLASGTL |
Ga0209733_11061122 | 3300027591 | Forest Soil | MGKKDGNVRMSLQTLRVLELFLESPTEQLSGAEVHQRCGIASGTL |
Ga0209530_10848271 | 3300027692 | Forest Soil | MGKEDRNPRMSLQTLRVLEVFLENPTAQLSGADVHESCG |
Ga0209579_104785071 | 3300027869 | Surface Soil | MGKDRDVRISLQTLRVLEAFLESPTDQLSGADVQKRSG |
Ga0209169_104209442 | 3300027879 | Soil | MGKKDTDVRMSLQTLRVLEVFLENPTVQLAGAEVHQHCGIASGTLYP |
Ga0209275_102892383 | 3300027884 | Soil | MGKTTGNVRMSLQTLRVLESFLENPLEQLSGADVHQRC |
Ga0209006_106699913 | 3300027908 | Forest Soil | MGKTTGNVRMSLQTLRVLESFLENPLEQLSGADVHQ |
Ga0209698_109049641 | 3300027911 | Watersheds | MGKKDAKVRMSLQTLRVLEAFLENPTEQLSGADVHQRCRIAS |
Ga0302232_100870214 | 3300028789 | Palsa | MSKRDRDVRMSLQTLKVLEAFLENPADELAGADVLQRCRLASGT |
Ga0302222_100834161 | 3300028798 | Palsa | MGKTATRVRMSLQTLRVLEIFLENPTEQLAGAEVHQ |
Ga0302235_102909801 | 3300028877 | Palsa | MGKTTDNVRMSLQTLRVLEAFLDNPVEQLSGSDVHQ |
Ga0311358_105808363 | 3300029915 | Bog | MGTRNPDVRMSLQTLRVLGAFLDNPTESLSGADVHRRSGLATGTLY |
Ga0311352_110474911 | 3300029944 | Palsa | MGKGIRDVRLSLQTLHVLEAFLENPTDQLSGADVQKRSRLAS |
Ga0311371_124396302 | 3300029951 | Palsa | MGKQDTNVRMSLQTLRVLEAFLEDPTGQLAGAELHQR |
Ga0311334_106819961 | 3300029987 | Fen | MGKQDRTVRMSLQTLRTLESFLENPNDELSGSDVQKRSGLASGT |
Ga0311336_109231093 | 3300029990 | Fen | MGKQDRDVRMSLQTLRVLEAFLEDPAGELAGADVQKLGHLASGTL |
Ga0311339_112570401 | 3300029999 | Palsa | MGTQDGNVRMSLQTLKVLEAFLENPGDALSGADVMQRCQVAS |
Ga0302305_12495081 | 3300030046 | Palsa | MGKQDRDVRMSLQTLRVLEAFLENPTDELSGADVQKRGRLAS |
Ga0311353_107990743 | 3300030399 | Palsa | MGKTTGNVRMSLQTLRVLESFLENPLEQLSGADVHQRCRIA |
Ga0311370_111733571 | 3300030503 | Palsa | MAKQIREVRMSLQTLKVLEAFLENPTDQMSGSEVH |
Ga0311370_120720121 | 3300030503 | Palsa | MGKQDTNVRMSLQTLRVLEAFLEDPTGQLAGAELHQRCGIAS |
Ga0311372_121293031 | 3300030520 | Palsa | MAKKDREVRMSLQTLQVLEAFLENPTEQLSGAEVHRRCGLASGTLY |
Ga0307482_13057332 | 3300030730 | Hardwood Forest Soil | MGKPIKDVRISLQTLRVLDAFLENPTADLAGSDVQKRGKLASGTLYP |
Ga0265753_10823291 | 3300030862 | Soil | MGKEDREVRMSLQTLKVLEAFLENPTDQLSGAEVHQRCK |
Ga0311366_105408313 | 3300030943 | Fen | MGTQDKDVRMSLQTLRVLEAFLENPTDALAGADVA |
Ga0170834_1040468452 | 3300031057 | Forest Soil | MGQKDTNVRMSLQTLRVLEVFLENPTELLAGADVHQ |
Ga0170824_1108646881 | 3300031231 | Forest Soil | MGKKDTTVRMSLQTLRVLEAFLENPTEQLAGAEVHQRC |
Ga0302307_104586992 | 3300031233 | Palsa | MGKKDTRVRMSLQTLRVLEAFLENPTQQLAGAEVHQRCGIASGTLYP |
Ga0302307_107215511 | 3300031233 | Palsa | MGKKDTNVRMSLQTLRVLESFLENPTVQLAGAEVHQRCG |
Ga0302325_130887101 | 3300031234 | Palsa | MGTQDGNVRMSLQTLKVLEAFLENPGDALSGADVMQRCQVASGTL |
Ga0302324_1007345911 | 3300031236 | Palsa | MGTDDRNVRMSLQTLKVLEAFLADPTRSLSGADVHEQSKIASGTLYP |
Ga0302324_1010742292 | 3300031236 | Palsa | MGKQERNVRMSLQTLRVLEAFLENPTEQLSGAEVHQRCGIASGTLYP |
Ga0265328_101807832 | 3300031239 | Rhizosphere | MGKPDREMRMSLQTLRVLEAFLAGPSEELAGADVARRGHI |
Ga0302320_101655121 | 3300031524 | Bog | MGKENRDVRMSLQTLKVLEAFLENPTDQLSGADVM |
Ga0302326_117419781 | 3300031525 | Palsa | MGTQDGNVRMSLQTLKVLEAFLENPGDALSGADVMQRCQVASG |
Ga0318542_104921751 | 3300031668 | Soil | MGSRDQVRISLQTLQVLEAFLENPAGELSGADVHRRSGIASGTL |
Ga0307373_103626722 | 3300031672 | Soil | MGRRDGDIRISLQTLRALEAFLENPSEELSGADVQKR |
Ga0318574_102862901 | 3300031680 | Soil | MVSRDVRMSLQTLKVLEAFLADPTDELSGADIHRRSGIASGTLY |
Ga0318574_104788761 | 3300031680 | Soil | MGDRDGNVRLSFQTLKVLEAFFQNPAGELSGADVHKRTEIASG |
Ga0318574_108839722 | 3300031680 | Soil | MGKRDRDVRMSLQTLRVLDAFLENPADELAGADVQKRSGL |
Ga0310686_1021690131 | 3300031708 | Soil | MGKDREVRMSLQTLRVLEAFLENPMGELAGADVQKRGQQIGRAHV |
Ga0318537_100229373 | 3300031763 | Soil | MVSRDVRMSLQTLKVLEAFLADPTDELSGADIHRRSGIASGT |
Ga0311367_104485653 | 3300031918 | Fen | MGKQDRDVRMSLQTLRVLEAFLEDPAGELAGADVQKLGHLASG |
Ga0310916_106386592 | 3300031942 | Soil | MVSRDVRMSLQTLKVLEAFLADPTDELSGADIHRRSGIA |
Ga0310909_111911412 | 3300031947 | Soil | MVSRDVRMSLQTLKVLEAFLADPTDELSGADIHRRSG |
Ga0307479_118889801 | 3300031962 | Hardwood Forest Soil | MSLQTLRVLDAFLENPTDELAGADVQKRSGLASGTLY |
Ga0318562_100721502 | 3300032008 | Soil | MGDRGGNVRLSFQTLKVLEAFLEKPTGELSGADVHKRTEIASG |
Ga0318558_103778061 | 3300032044 | Soil | MVSRDVRMSLQTLKVLEAFLADPTDELSGADIHRRSGIASGTL |
Ga0335082_108814251 | 3300032782 | Soil | MGTDRPVRMSLQTLRVLEAFLENPRGEFAGSDLQKR |
Ga0335077_104403211 | 3300033158 | Soil | MGRQDRDVRISLQTLKVLEAFLENPTEEISGADVHRRSG |
Ga0334840_112218_613_744 | 3300033824 | Soil | MGKKDTKVRMSLQTLRVLEAFLENPTVQLAGADVHQRCGIASGT |
Ga0370515_0093579_1149_1298 | 3300034163 | Untreated Peat Soil | MGKQAHDVRMSLQTLKVLEPFLESPADEFSGADLLQRFRLASGTLYPILL |
Ga0370492_0141974_832_981 | 3300034282 | Untreated Peat Soil | MGKKDKDTPVRMSLQTLRVLEAFLENPTAQLAGAEVHQRCGIASGTLYPI |
⦗Top⦘ |