NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078788

Metagenome / Metatranscriptome Family F078788

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078788
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 54 residues
Representative Sequence MMKEILRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Number of Associated Samples 96
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 40.52 %
% of genes near scaffold ends (potentially truncated) 37.07 %
% of genes from short scaffolds (< 2000 bps) 84.48 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.414 % of family members)
Environment Ontology (ENVO) Unclassified
(58.621 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(65.517 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.40%    β-sheet: 0.00%    Coil/Unstructured: 56.60%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00112Peptidase_C1 75.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1067224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300000736|JGI12547J11936_1069355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300000949|BBAY94_10187520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300004767|Ga0007750_1293894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1211Open in IMG/M
3300004767|Ga0007750_1395619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1005Open in IMG/M
3300004789|Ga0007752_11079871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2028Open in IMG/M
3300004792|Ga0007761_11106173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300005516|Ga0066831_10015180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2108Open in IMG/M
3300006357|Ga0075502_1185993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300006394|Ga0075492_1299454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300007513|Ga0105019_1082542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1795Open in IMG/M
3300008108|Ga0114341_10070290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2207Open in IMG/M
3300008108|Ga0114341_10083099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1983Open in IMG/M
3300008832|Ga0103951_10624876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300008962|Ga0104242_1084492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300008993|Ga0104258_1025289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1109Open in IMG/M
3300009054|Ga0102826_1114033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300009071|Ga0115566_10063562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2458Open in IMG/M
3300009071|Ga0115566_10243942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1078Open in IMG/M
3300009071|Ga0115566_10448188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium738Open in IMG/M
3300009079|Ga0102814_10310346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium858Open in IMG/M
3300009086|Ga0102812_10746051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300009216|Ga0103842_1034737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium579Open in IMG/M
3300009338|Ga0103826_115789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300009432|Ga0115005_10104369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2179Open in IMG/M
3300009434|Ga0115562_1228867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300009441|Ga0115007_10049609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2624Open in IMG/M
3300009495|Ga0115571_1209665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium794Open in IMG/M
3300009592|Ga0115101_1098393All Organisms → cellular organisms → Eukaryota1105Open in IMG/M
3300009677|Ga0115104_11131467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300009677|Ga0115104_11177936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300009679|Ga0115105_10445819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2094Open in IMG/M
3300010981|Ga0138316_11518657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300012419|Ga0138260_10443639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300012504|Ga0129347_1237637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1139Open in IMG/M
3300012767|Ga0138267_1080844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium534Open in IMG/M
3300012782|Ga0138268_1058833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1570Open in IMG/M
3300012954|Ga0163111_10251477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1550Open in IMG/M
3300012969|Ga0129332_1381858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium782Open in IMG/M
3300013006|Ga0164294_10086292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2350Open in IMG/M
3300018418|Ga0181567_10087881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2166Open in IMG/M
3300018762|Ga0192963_1070344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300018874|Ga0192977_1111285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300018982|Ga0192947_10173225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300018982|Ga0192947_10195406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium667Open in IMG/M
3300018982|Ga0192947_10236858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium590Open in IMG/M
3300018989|Ga0193030_10024497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1346Open in IMG/M
3300018989|Ga0193030_10144664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium766Open in IMG/M
3300019031|Ga0193516_10060176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1273Open in IMG/M
3300019032|Ga0192869_10106971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1091Open in IMG/M
3300019032|Ga0192869_10216539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium820Open in IMG/M
3300019036|Ga0192945_10113422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium860Open in IMG/M
3300019036|Ga0192945_10275391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300019050|Ga0192966_10003938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2668Open in IMG/M
3300019051|Ga0192826_10388998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300019095|Ga0188866_1004655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1207Open in IMG/M
3300019095|Ga0188866_1009958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium938Open in IMG/M
3300019095|Ga0188866_1028174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300019117|Ga0193054_1037223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300019131|Ga0193249_1061118All Organisms → cellular organisms → Eukaryota914Open in IMG/M
3300019149|Ga0188870_10110997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300020074|Ga0194113_10588107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium787Open in IMG/M
3300020084|Ga0194110_10497563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium797Open in IMG/M
3300021169|Ga0206687_1127808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300021350|Ga0206692_1855791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300021355|Ga0206690_10257481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium836Open in IMG/M
3300021378|Ga0213861_10470914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300021869|Ga0063107_118867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300021887|Ga0063105_1053612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300021898|Ga0063097_1100282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021913|Ga0063104_1040993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1157Open in IMG/M
3300021941|Ga0063102_1085536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1155Open in IMG/M
3300021962|Ga0222713_10792704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300025640|Ga0209198_1164559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300025690|Ga0209505_1093650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium870Open in IMG/M
3300025830|Ga0209832_1208376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300026182|Ga0208275_1010483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2047Open in IMG/M
3300026447|Ga0247607_1102060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300026448|Ga0247594_1059081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M
3300026449|Ga0247593_1104456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300026495|Ga0247571_1094237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300027249|Ga0208175_1028079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300027255|Ga0208681_1083776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300027810|Ga0209302_10037037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2678Open in IMG/M
3300027849|Ga0209712_10095737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1718Open in IMG/M
3300027849|Ga0209712_10608242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300027963|Ga0209400_1246063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300028099|Ga0247576_1064891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300028282|Ga0256413_1040669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1586Open in IMG/M
3300028282|Ga0256413_1278635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300030671|Ga0307403_10797028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300030709|Ga0307400_10047319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2189Open in IMG/M
3300030725|Ga0308128_1002074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2120Open in IMG/M
3300031036|Ga0073978_1001360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300031062|Ga0073989_13247492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300031062|Ga0073989_13378445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300031710|Ga0307386_10021720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2055Open in IMG/M
3300031710|Ga0307386_10339994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300031717|Ga0307396_10020635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2321Open in IMG/M
3300031729|Ga0307391_10024070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2224Open in IMG/M
3300031729|Ga0307391_10911990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300031734|Ga0307397_10166121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium961Open in IMG/M
3300031750|Ga0307389_10965998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300031784|Ga0315899_10612868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1025Open in IMG/M
3300031784|Ga0315899_11346174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium608Open in IMG/M
3300032517|Ga0314688_10293910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium864Open in IMG/M
3300032520|Ga0314667_10662651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300032521|Ga0314680_10030374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2022Open in IMG/M
3300032650|Ga0314673_10065520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1422Open in IMG/M
3300032666|Ga0314678_10081769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1217Open in IMG/M
3300032708|Ga0314669_10026716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1881Open in IMG/M
3300032708|Ga0314669_10539300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300032732|Ga0314711_10560985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300032746|Ga0314701_10524035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300032750|Ga0314708_10442475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300034021|Ga0335004_0283403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium988Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine18.10%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.62%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.90%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.90%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.90%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.45%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.59%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.59%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.72%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.86%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.86%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.86%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.86%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.86%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.86%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.86%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009338Microbial communities of water from the North Atlantic ocean - ACM29EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027255Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028099Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 33R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_106722423300000736Freshwater And SedimentILRNGIVNGELNVPRIFSFYQKGILSNDHESKMSSYLEYSGIAEHHKVA*
JGI12547J11936_106935533300000736Freshwater And SedimentMMKEILRNGVVNGELQVPGVFSFYREGILSNDHEANMSAYLEYTGAAANHK*
BBAY94_1018752023300000949Macroalgal SurfaceMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHK*
Ga0007750_129389423300004767Freshwater LakeMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE*
Ga0007750_139561923300004767Freshwater LakeMMKEILRNGIANGELNVPRVFSFYQQGILSNDHEAKMSSYLEYSGVAAHHKEA*
Ga0007752_1107987153300004789Freshwater LakeMMKEILKNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE*
Ga0007761_1110617313300004792Freshwater LakeMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYS
Ga0066831_1001518053300005516MarineMMKEMLRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQ*
Ga0075502_118599323300006357AqueousKELLRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVASHHKEAQ*
Ga0075492_129945413300006394AqueousGIVNGELNVPKVFSFYQQGILSNDHEAKMSSYLEYSGVAAHHKEAQ*
Ga0105019_108254253300007513MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAANHK*
Ga0114341_1007029053300008108Freshwater, PlanktonMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE*
Ga0114341_1008309923300008108Freshwater, PlanktonMKEILRNGIANGELNVPRVFSFYQQGILSNDHEAKMSSYLEYSGVAAHHKEA*
Ga0103951_1062487613300008832MarineMGKEISHKGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVASDHK*
Ga0104242_108449223300008962FreshwaterMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHESKMSSYLEYSGIAEHHK*
Ga0104258_102528923300008993Ocean WaterMMKEILHKGIVNGELNVTRVFSFYQQGILSNDHESKMSSYLEYSGVASSHKEAQQQIGVD
Ga0102826_111403323300009054EstuarineEKKMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQAQQLIGTDEEKK*
Ga0115566_1006356223300009071Pelagic MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQLIGSEEQKKSRA*
Ga0115566_1024394223300009071Pelagic MarineMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQ*
Ga0115566_1044818823300009071Pelagic MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHK*
Ga0102814_1031034623300009079EstuarineMMKEILRNGIVNGELNVPKVFSFYQQGILSNDHEAKMSSYLEYSGVAAHHKQDQQLIGTPEQKQ
Ga0102812_1074605123300009086EstuarineGESSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Ga0103842_103473723300009216River WaterRNGIINGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK*
Ga0103826_11578913300009338River WaterMMKEILRNGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVAAHHKESQ
Ga0115005_1010436923300009432MarineMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKLAQ*
Ga0115562_122886723300009434Pelagic MarineMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAA
Ga0115007_1004960923300009441MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAASHK*
Ga0115571_120966513300009495Pelagic MarineMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQA*
Ga0115101_109839323300009592MarineMMKEILRNGVVNGELNVPHVFSFYSQGILSNDHEAKMSSYLEYSGVAAHHKEAQQLIGVEADIK*
Ga0115104_1113146723300009677MarineEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA*
Ga0115104_1117793613300009677MarineMMREILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHKMAQ*
Ga0115105_1044581953300009679MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK*
Ga0138316_1151865723300010981MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKQVQ*
Ga0138260_1044363923300012419Polar MarineLRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGIAEHHKET*
Ga0129347_123763723300012504AqueousMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEA*
Ga0138267_108084413300012767Polar MarineKMMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKLA*
Ga0138268_105883323300012782Polar MarineMKEILRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEAQQMIGGSKRK
Ga0163111_1025147723300012954Surface SeawaterMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQMIGSED*
Ga0129332_138185823300012969AqueousMMKEILRNGIVNGELNVPRIFSFYQKGILSHDHEAKMSSYLEYSGLAEHHK*
Ga0164294_1008629223300013006FreshwaterMKEILKNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE*
Ga0181567_1008788143300018418Salt MarshMMKEILRNGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVAAHHKEAQ
Ga0192963_107034423300018762MarineYGESSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK
Ga0192977_111128513300018874MarineMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEA
Ga0192947_1017322523300018982MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Ga0192947_1019540613300018982MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAANHKQEQ
Ga0192947_1023685813300018982MarineMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQLIGSEEQKKSRA
Ga0193030_1002449723300018989MarineMMKELLRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEA
Ga0193030_1014466433300018989MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAENHKEIQ
Ga0193516_1006017623300019031MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK
Ga0192869_1010697123300019032MarineMMKDILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Ga0192869_1021653923300019032MarineMMKEMLRNGILNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAQHKQE
Ga0192945_1011342213300019036MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQLIGSEEQKKSRA
Ga0192945_1027539113300019036MarineGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQQMIGTDE
Ga0192966_1000393823300019050MarineMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHK
Ga0192826_1038899813300019051MarineGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAANHK
Ga0188866_100465523300019095Freshwater LakeMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQ
Ga0188866_100995823300019095Freshwater LakeMMKEILRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Ga0188866_102817413300019095Freshwater LakeMREILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHKMAQ
Ga0193054_103722323300019117MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAANHK
Ga0193249_106111823300019131MarineMMQEILLNGPVNGELQVPKAFSFYQKGILSNDHESKMDEYLEYSGAASHHKEEQ
Ga0188870_1011099713300019149Freshwater LakeMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQAQQLIGTD
Ga0194113_1058810723300020074Freshwater LakeMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE
Ga0194110_1049756323300020084Freshwater LakeMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE
Ga0206687_112780823300021169SeawaterMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSQYLEYSGVAEHHKQAQQMIGVK
Ga0206692_185579113300021350SeawaterMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQQMIGTD
Ga0206690_1025748123300021355SeawaterMMKDLLRNGIINGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK
Ga0213861_1047091423300021378SeawaterMMKEILRNGIANGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAENHKLAQQSIG
Ga0063107_11886713300021869MarineGYGESSEKKMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAASHK
Ga0063105_105361223300021887MarineVNHPRKKMMKELLRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKIA
Ga0063097_110028223300021898MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAASHK
Ga0063104_104099323300021913MarineMMKELLRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKIA
Ga0063102_108553613300021941MarineMMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKLAQ
Ga0222713_1079270413300021962Estuarine WaterNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEA
Ga0209198_116455923300025640Pelagic MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGV
Ga0209505_109365023300025690Pelagic MarineMMKEILHKGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVASNHKEAQQQIGVD
Ga0209832_120837613300025830Pelagic MarineGESSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHK
Ga0208275_101048333300026182MarineMMKEMLRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEA
Ga0247607_110206013300026447SeawaterMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQQMIGTDEQKKS
Ga0247594_105908113300026448SeawaterKMMKEILHKGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVAANHKEAQQLIGADEKS
Ga0247593_110445613300026449SeawaterMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQQMIG
Ga0247571_109423713300026495SeawaterMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQQMIGT
Ga0208175_102807923300027249EstuarineKEILRNGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVAAHHKEAQ
Ga0208681_108377623300027255EstuarineSEEKMMKEILRNGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVAAHHKEAQ
Ga0209302_1003703723300027810MarineMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAASHK
Ga0209712_1009573713300027849MarineMMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYS
Ga0209712_1060824223300027849MarineSEKKMMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKLAQ
Ga0209400_124606323300027963Freshwater LakeSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHESKMSSYLEYSGIAEHHKVA
Ga0247576_106489123300028099SeawaterMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHKQVQQMIGS
Ga0256413_104066933300028282SeawaterMKEILRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEAQ
Ga0256413_127863523300028282SeawaterMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHKEAQQMIGKNK
Ga0307403_1079702823300030671MarineMKEILRNGVVNGEINVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHKLAQ
Ga0307400_1004731933300030709MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEA
Ga0308128_100207463300030725MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQMIGNAEQKASRA
Ga0073978_100136013300031036MarineMMKEILRNGIVNGELNVPKVFSFYSEGILSNDHEAKMSSYLEYSGVASQHKVE
Ga0073989_1324749223300031062MarineMMKELLRNGMVNGELNVPRVFAFYQEGILSNDHESKMSSYLEYSGVAAQHKVE
Ga0073989_1337844523300031062MarineMMKEILMNGPVNGELQVPKAFSFYQKGILSNDHESKMSSYLEYSGAASQHKEE
Ga0307386_1002172023300031710MarineMMKEILRNGIVNGELNVPRVFSFYQQGILSNDHEAKMSSYLEYSGVAAQHKEA
Ga0307386_1033999413300031710MarineMENLQRKKMMKDLMRNGIINGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAEHHK
Ga0307396_1002063543300031717MarineMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQ
Ga0307391_1002407023300031729MarineMMKEILRNGIVNGELNVPRVFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEAQ
Ga0307391_1091199023300031729MarineAYGESSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGVAEHHKEAQ
Ga0307397_1016612123300031734MarineMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQ
Ga0307389_1096599823300031750MarineSSEKKMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAANHKQEQ
Ga0315899_1061286823300031784FreshwaterMMKEILRNGIANGELNVPRVFSFYQQGILSNDHEAKMSSYLEYSGVAAHHKEA
Ga0315899_1134617413300031784FreshwaterGGAYGESSEKKMMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE
Ga0314688_1029391023300032517SeawaterMMKEILRNGIVNGELNVPRFFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQ
Ga0314667_1066265123300032520SeawaterGMVNGELNVPRVFAFYQEGILSNDHESKMSSYLEYSGVAAEHKVE
Ga0314680_1003037443300032521SeawaterMMKEILHKGIVNGELNVPRVFSFYQQGILSNDHESKMSSYLEYSGVASSHKEAQQQIGVD
Ga0314673_1006552023300032650SeawaterMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHK
Ga0314678_1008176923300032666SeawaterMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVASHHKEAQ
Ga0314669_1002671643300032708SeawaterMKEILRNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGLAEHHK
Ga0314669_1053930013300032708SeawaterMMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQA
Ga0314711_1056098513300032732SeawaterMMKEILRNGIVNGELNVPRVFSFYQEGILSNDHEAKMSSYLEYSGVAAHHKEAQQLI
Ga0314701_1052403513300032746SeawaterNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQA
Ga0314708_1044247513300032750SeawaterAYGESSEKKVMKEILRNGIVNGELNVPRVFSYYQEGILSNDHEAKMSSYLEYSGVAAHHKQA
Ga0335004_0283403_445_5913300034021FreshwaterMMKEILKNGIVNGELNVPRIFSFYQKGILSNDHEAKMSSYLEYSGIAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.