NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078261

Metagenome / Metatranscriptome Family F078261

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078261
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 50 residues
Representative Sequence MNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCAHYEKC
Number of Associated Samples 95
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.59 %
% of genes near scaffold ends (potentially truncated) 54.31 %
% of genes from short scaffolds (< 2000 bps) 91.38 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(19.828 % of family members)
Environment Ontology (ENVO) Unclassified
(49.138 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(47.414 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.18%    β-sheet: 0.00%    Coil/Unstructured: 80.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00112Peptidase_C1 43.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10150094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300004767|Ga0007750_1293894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1211Open in IMG/M
3300004789|Ga0007752_11079871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2028Open in IMG/M
3300004792|Ga0007761_11106173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300004793|Ga0007760_11261401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300004836|Ga0007759_11397494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300005942|Ga0070742_10154584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea638Open in IMG/M
3300006116|Ga0007807_1104140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea519Open in IMG/M
3300007513|Ga0105019_1049225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2542Open in IMG/M
3300007513|Ga0105019_1082542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1795Open in IMG/M
3300007722|Ga0105051_10882096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300008108|Ga0114341_10070290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2207Open in IMG/M
3300008108|Ga0114341_10091875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1861Open in IMG/M
3300008111|Ga0114344_1041439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1798Open in IMG/M
3300008119|Ga0114354_1088391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1249Open in IMG/M
3300008962|Ga0104242_1084492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300008993|Ga0104258_1012663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1556Open in IMG/M
3300009151|Ga0114962_10213542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1119Open in IMG/M
3300009160|Ga0114981_10455665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300009187|Ga0114972_10553308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300009195|Ga0103743_1066078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300009436|Ga0115008_10241204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1287Open in IMG/M
3300009437|Ga0115556_1102229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1094Open in IMG/M
3300009466|Ga0126448_1014226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1954Open in IMG/M
3300009496|Ga0115570_10359427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300009505|Ga0115564_10249149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300009507|Ga0115572_10472935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300009538|Ga0129287_10058156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1633Open in IMG/M
3300009599|Ga0115103_1250095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1210Open in IMG/M
3300009599|Ga0115103_1630223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300009608|Ga0115100_10385933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium812Open in IMG/M
3300009608|Ga0115100_10685365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300009677|Ga0115104_10909512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300009679|Ga0115105_10445819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2094Open in IMG/M
3300012416|Ga0138259_1136392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1124Open in IMG/M
3300012767|Ga0138267_1155949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium921Open in IMG/M
3300012782|Ga0138268_1615011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium971Open in IMG/M
3300012953|Ga0163179_10308060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1255Open in IMG/M
3300012953|Ga0163179_10421409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1087Open in IMG/M
3300013295|Ga0170791_10348611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300013295|Ga0170791_13194109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300018607|Ga0188821_1015204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300018874|Ga0192977_1031322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1054Open in IMG/M
3300018905|Ga0193028_1002954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2321Open in IMG/M
3300018926|Ga0192989_10054445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1028Open in IMG/M
3300018989|Ga0193030_10024497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1346Open in IMG/M
3300019021|Ga0192982_10306546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300019022|Ga0192951_10212484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium713Open in IMG/M
3300019031|Ga0193516_10060176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1273Open in IMG/M
3300019031|Ga0193516_10116359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium909Open in IMG/M
3300019032|Ga0192869_10106971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1091Open in IMG/M
3300019045|Ga0193336_10246592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani752Open in IMG/M
3300019150|Ga0194244_10045341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300019200|Ga0180036_1061894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300020074|Ga0194113_10553019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium819Open in IMG/M
3300020074|Ga0194113_10921026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300020083|Ga0194111_10560353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300020083|Ga0194111_10602715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300020084|Ga0194110_10787714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300020172|Ga0211729_10088713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium935Open in IMG/M
3300021376|Ga0194130_10198234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1188Open in IMG/M
3300021872|Ga0063132_115561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium651Open in IMG/M
3300021902|Ga0063086_1005779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300021902|Ga0063086_1063128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium878Open in IMG/M
3300021913|Ga0063104_1040993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1157Open in IMG/M
3300021913|Ga0063104_1079951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium835Open in IMG/M
3300021927|Ga0063103_1080692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300025389|Ga0208257_1041861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300025636|Ga0209136_1154770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300025785|Ga0208498_1036487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300026465|Ga0247588_1014100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1471Open in IMG/M
3300026471|Ga0247602_1113174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300027810|Ga0209302_10037037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2678Open in IMG/M
3300028102|Ga0247586_1090086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300028134|Ga0256411_1015472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2248Open in IMG/M
3300028137|Ga0256412_1064469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1297Open in IMG/M
3300028137|Ga0256412_1072917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1223Open in IMG/M
3300028137|Ga0256412_1363087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300028282|Ga0256413_1040669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1586Open in IMG/M
3300028282|Ga0256413_1049924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1454Open in IMG/M
3300028282|Ga0256413_1338225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium527Open in IMG/M
3300028290|Ga0247572_1092892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300030671|Ga0307403_10063195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1660Open in IMG/M
3300030709|Ga0307400_10047319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2189Open in IMG/M
3300030709|Ga0307400_10213103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1210Open in IMG/M
3300030788|Ga0073964_11069050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300030856|Ga0073990_11800558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1157Open in IMG/M
3300031062|Ga0073989_13100106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium566Open in IMG/M
3300031522|Ga0307388_10422813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum867Open in IMG/M
3300031710|Ga0307386_10021720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2055Open in IMG/M
3300031729|Ga0307391_10082647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1491Open in IMG/M
3300031737|Ga0307387_10757094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300031738|Ga0307384_10340746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300031738|Ga0307384_10531012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300031739|Ga0307383_10271003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum816Open in IMG/M
3300031739|Ga0307383_10305669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300031750|Ga0307389_10471701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium801Open in IMG/M
3300031784|Ga0315899_11226256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300032092|Ga0315905_11341317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300032360|Ga0315334_11569984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300032481|Ga0314668_10020073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2245Open in IMG/M
3300032519|Ga0314676_10436273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium780Open in IMG/M
3300032615|Ga0314674_10684157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300032616|Ga0314671_10047627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1828Open in IMG/M
3300032616|Ga0314671_10524102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300032651|Ga0314685_10352672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum815Open in IMG/M
3300032651|Ga0314685_10495633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300032651|Ga0314685_10645164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300032707|Ga0314687_10051675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1644Open in IMG/M
3300032708|Ga0314669_10411336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300032714|Ga0314686_10465652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300032730|Ga0314699_10575412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300032734|Ga0314706_10033267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1832Open in IMG/M
3300032752|Ga0314700_10088550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1424Open in IMG/M
3300034021|Ga0335004_0283403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium988Open in IMG/M
3300034107|Ga0335037_0438094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.83%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.66%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater12.07%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.17%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.45%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.59%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.72%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.86%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.86%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.86%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.86%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.86%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.86%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.86%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.86%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006116Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300018607Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dTEnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1015009423300001354Pelagic MarineMQXNXMNEGCDGGWSFFHGYMAENGHMVSEKCAPYMSRTKGLTCGQYSNCSTEAKV*
Ga0007750_129389413300004767Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSHYEKC*
Ga0007752_1107987143300004789Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCAHYEKC*
Ga0007761_1110617323300004792Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKRDKCSYYEKC*
Ga0007760_1126140123300004793Freshwater LakeCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSYYEKC*
Ga0007759_1139749413300004836Freshwater LakeCNYMNEGCDGGWSFFHGYLTENGHLVSEQCAPYEGRTKGVTCSKYK*
Ga0070742_1015458413300005942EstuarineMQCNYMNEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKGHTCG*
Ga0007807_110414033300006116FreshwaterMMMCNYMNEGCDGGWPLFMGILESKYLVTEECAPYQGKTKGINAQIMD
Ga0105019_104922543300007513MarineMNEGCDGGWPFFHGFFAENGYLVTDDCAPYMAKTKGDACENYSKCEPHSKI*
Ga0105019_108254243300007513MarineMNEGCDGGWSFFHGYLAENGYMVSEDCAPYIAKTKGEKCSKY*
Ga0105051_1088209623300007722FreshwaterDGGWSFFHGFMAENGHMVSEKCAPYLAKTKGQKCG*
Ga0114341_1007029043300008108Freshwater, PlanktonMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDQCSHYEKC*
Ga0114341_1009187523300008108Freshwater, PlanktonLSEGCRGGWSIFNGFFAENGYLVEESCAPYTGRTKGRSCGDF*
Ga0114344_104143943300008111Freshwater, PlanktonMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDQCSHYEKC*
Ga0114354_108839113300008119Freshwater, PlanktonMNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKDDKCSNYKKCDPI
Ga0104242_108449213300008962FreshwaterMNEGCDGVWSFFHGFLAENGYMVSEKCAPYKAKTKDDKCSNYKHCDPIAKIKKKVIS*
Ga0104258_101266313300008993Ocean WaterMTCNYLTEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKGVSCGTYGKCKPMAKIKESYFV
Ga0114962_1021354233300009151Freshwater LakeMNEGCDGGWPLFHGYLGEQGYLVTEECAPYLGKTKGDQ
Ga0114981_1045566513300009160Freshwater LakeMNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKDDKCS
Ga0114972_1055330813300009187Freshwater LakeMMMCNYMNEGCDGGWPLFHGYLGEQGYLVTEECAPYLGKTKGDQCSNYAHCEPHS
Ga0103743_106607813300009195Ice Edge, Mcmurdo Sound, AntarcticaMTCNYLTEGCDGGWSFYHGFLGENGYLVSEKCAPYKAKTKGESCGSYGKCKPIA
Ga0115008_1024120413300009436MarineMNEGCDGGWPFFHGFLAENGHMVTEECAPYRGKTKGDKCSNYAECAP
Ga0115556_110222933300009437Pelagic MarineMQCNYMNEGCDGGWSFFHGYMAENGHMVSEKCAPYMSRTKGLTCGQYSNCSTEAK
Ga0126448_101422653300009466Meromictic PondMTCNYLNEGCDGGWSFFHGYLAENGHLASEKCAPYLAKTKGETCGKYA*
Ga0115570_1035942713300009496Pelagic MarineMQCNYMNEGCDGGWSFLHGYLTENGAMVTEKCAPYQAKTKGFSCA*
Ga0115564_1024914923300009505Pelagic MarineMNEGCDGGWPFFHGFMAENGYLVTEECAPYKGKTKGDTCANYEGCAPHSKI*
Ga0115572_1047293513300009507Pelagic MarineMNEGCDGGWSFFHGYLGENGYFVSEKCAPYKHSTKNDKCSNYEHCKPIA
Ga0129287_1005815633300009538Beach Aquifer PorewaterMNEGCDGGWPFFHGYFGENGYLVTEECAPYQGRTKGDNC*
Ga0115103_125009523300009599MarineMTCNYLTEGCDGGWSFFHGYLAENGYMVSEKCAPYKAKTKGDHCSSYAQCKPISKI*
Ga0115103_163022313300009599MarineMNEGCDGGWSFFHGYLGENGYFVSEKCAPYKHSTKNDKCGNYEHCKPIAKTEESYFVGGAYGESSEKKMMKEIL
Ga0115100_1038593323300009608MarineMMCNYLNEGCDGGWSFFHGFLAENGYMVSEKCAPYLAKTKGDSCKSYEKCKPIAKVK*
Ga0115100_1068536523300009608MarineMNEGCDGGWSFFHGYLGENGYFVSEKCAPYKHSTKNDKCSNYEHCKPIAKTEESYFVG
Ga0115104_1090951223300009677MarineMNEGCDGGWPFFHGFFAENGYLVTDECAPYMAKTKGDSCDNYAKC
Ga0115105_1044581943300009679MarineMTCNYLTEGCDGGWSFYHGFLGENGYLVSEKCSPYKAKTKGDQCGKYK*
Ga0138259_113639213300012416Polar MarineMNEGCDGGWSFFQGYLGENGYFVSEKCAPYKHSTKNDKCSNYEHCKPIAKTEESYFVGGAYGESSEKKMMKEI
Ga0138267_115594923300012767Polar MarineMNEGCDGGWSFFQGYLGENGYFVSEKCAPYKHSTKNDKCSNYEHCKPIAKTEESYFV
Ga0138268_161501123300012782Polar MarineMQCNYMNEGCDGGWSFFHGYLGENGYIVDETCAPYLAKTKGESCGNYKKCKPISRI*
Ga0163179_1030806013300012953SeawaterMNEGCDGGWPFFHGFLAENGYLVTEECAPYMGKTKGDNCANYA*
Ga0163179_1042140933300012953SeawaterMNEGCDGGWPFFHGFLAENGYLVTEECAPYIGKTKGDSCSNYA*
Ga0170791_1034861113300013295FreshwaterMNEGCDGGWPLFHGYLAEQGYLVTEECAPYQGKTKGE
Ga0170791_1319410913300013295FreshwaterMNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKDD*
Ga0188821_101520413300018607Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSYYEKC
Ga0192977_103132223300018874MarineMQCNYMNEGCDGGWSFFHGYLGENGYIVDETCAPYLAKTKGESCGNYKKCKPISRI
Ga0193028_100295423300018905MarineMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKSDKCANYQHC
Ga0192989_1005444513300018926MarineMNEGCDGGWPFFHGFMAENGYLVTEECAPYKGKTKGDTCANYEGCAPHSKI
Ga0193030_1002449713300018989MarineMNEGCDGGWSFFHGYLAENGHLVDEKCAPYLGKTKGETCGKYKQCQPISTIKDSYFIGGAYG
Ga0192982_1030654613300019021MarineMTCNYLTEGCDGGWSFYHGFLGENGYFVTEKCAPYKAKTKGDKCGLYSKCKPISKIKESYFIG
Ga0192951_1021248413300019022MarineMQCNYMNEGCDGGWSFFHGFLGENGYLVDEKCAPYLAKTKGESCGAYNKCKPISDIK
Ga0193516_1006017633300019031MarineMTCNYLTEGCDGGWSFYHGFLGENGYLVSEKCSPYKAKTKGDQCGKYK
Ga0193516_1011635913300019031MarineMQCNYMNEGCDGGWSFFHGYLAENGYMVTEECAPYIAKTKGEKCGKYKKC
Ga0192869_1010697113300019032MarineMTCNYLTEGCDGGWSFFHGYLAENGYLVEEKCAPYKAKTKGEHCGQYA
Ga0193336_1024659223300019045MarineMQCNYLTEGCDGGWSFYHGFLAENSHMVSEKCAPYKGKTKGVKCSDYKECPPH
Ga0194244_1004534123300019150MarineMNEGCDGGWSFFHGFLAENGYMVTEKCAPYQAMTKGFTCGSYKDCKPASKVT
Ga0180036_106189413300019200EstuarineMNEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTK
Ga0194113_1055301913300020074Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSHYE
Ga0194113_1092102623300020074Freshwater LakeMNEGCDGGWSFFHGYLAENGHLVSEQCAPYEGRTKGVTCSKYK
Ga0194111_1056035323300020083Freshwater LakeCNYMNEGCDGGWSFFHGYLAENGHLVSEQCAPYEGRTKGVTCSKYK
Ga0194111_1060271523300020083Freshwater LakeMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSHYEKC
Ga0194110_1078771413300020084Freshwater LakeEGCDGGWSFFHGYLAENGHLVSEQCAPYEGRTKGVTCSKYK
Ga0211729_1008871323300020172FreshwaterMNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCAHYEKC
Ga0194130_1019823423300021376Freshwater LakeMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSHYEKC
Ga0063132_11556113300021872MarineCDGGWSFFHGFLAENGYMVTEKCAPYQAMTKGFTCGSYKDCKPASKVT
Ga0063086_100577923300021902MarineMNEGCDGGWPFFHGFFAENGYLVTDDCAPYLAKTKGDKCENYSKCEPHSKI
Ga0063086_106312823300021902MarineMTCNYLTEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKGQSC
Ga0063104_104099313300021913MarineMNEGCDGGWSFFHGYLGENGYFVSEKCAPYKHSTKND
Ga0063104_107995123300021913MarineMTCNYLTEGCDGGWSFYHGYLGENGYLVSEKCAPYKAKTKGESCAGYGKCKPIAKIKDSYFIGGAYGESSE
Ga0063103_108069213300021927MarineMQCNYMNEGCDGGWSFLHGYLTENGAMVTEQCAPYQAKTKGMSCA
Ga0208257_104186113300025389FreshwaterMVCNYMNEGCDGGWSFFHGFLAENGYMVSEKCAPYKAKTKDDKCSNYKH
Ga0209136_115477013300025636MarineMNEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKG
Ga0208498_103648723300025785FreshwaterMVCNYMNEGCDGGWSFFHGFLAENGYMVSEKCAPYKAKTKD
Ga0247588_101410043300026465SeawaterMNEGCDGGWSYFHGYLAENGYLVSEKCAPYKAKTKGFTCGQYEKCKPIAKIKESYFIGGA
Ga0247602_111317413300026471SeawaterGWPVFHGFMAENGYLVTEDCAPYTGKTKGDSCSNY
Ga0209302_1003703733300027810MarineMQCNYMNEGCDGGWSFFHGYLAESGYMVSEECAPYIAKTKGEHCSKYKSCKPISNI
Ga0247586_109008623300028102SeawaterMQCNYMNEGCDGGWSFFHGYLAEGGYMVSEECAPYLAKTK
Ga0256411_101547223300028134SeawaterMGCNYLTEGCDGGWSFFHGYLGENGYLVSEKCAPYLAKTKGDKCGNYKNCKPIMKIKESYFIGGA
Ga0256412_106446923300028137SeawaterMMCNYLNEGCDGGWSFFHGFLAENGYMVSEKCAPYLAKTKGDSCKSYEKCKPIAKVK
Ga0256412_107291713300028137SeawaterMNEGCDGGWSFFHGYLAENGHLVDEQCAPYLGKTKGETCAKYEKCKPIATIQDSFFIGG
Ga0256412_136308713300028137SeawaterMMCNYMNEGCDGGWSFFHGFLAENGYLVSEKCAPYIAKTKEDT
Ga0256413_104066923300028282SeawaterMTCNYLTEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKGQSCGLYSKCKPIAKIKESYFIGGAYGESSELK
Ga0256413_104992423300028282SeawaterMNEGCDGGWSFFHGYLGENGYFVSEKCAPYKHSTKGDKCGNYEHC
Ga0256413_133822513300028282SeawaterMNEGCDGGWPFFHGFFAENGYLVTDECAPYMAKTKGDSCDNYAKCAPHSKI
Ga0247572_109289223300028290SeawaterNEGCDGGWSFFHGYLAENGHLVDEQCAPYLGKTKGETCAKYEKCKPIATIQDSFFIGGAY
Ga0307403_1006319533300030671MarineMTCNYMNEGCDGGWSFFHGYLAENGHLVDEQCAPYLGKTKGETCGKYEQCKPIATI
Ga0307400_1004731923300030709MarineMTCNYMNEGCDGGWSFFHGYLAENGHLVDEQCAPYLGKTKGETCG
Ga0307400_1021310333300030709MarineMNEGCDGGWPFFHGFMAENGYLVTEECAPYKGKTKGDSCANYEGCAPHSKI
Ga0073964_1106905013300030788MarineMNEGCDGGWSFFHGFLAENGYMVTEKCAPYQAMTKGFTCGSYKDCKPAAKITQ
Ga0073990_1180055823300030856MarineMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKSDKCANYQHCKPIAK
Ga0073989_1310010623300031062MarineMTCNYLTEGCDGGWSFFHGYLAENGYLVSEKCAPYKAKTKGVSCGTYGKCKPMAKIKESYFVGGAYG
Ga0307388_1042281323300031522MarineMNEGCDGGWSILHSFLTETGYLVSEECAPYEGVTKGKKC
Ga0307386_1002172033300031710MarineMNEGCDGGWSFFHGYLAENGHMVDETCAPYLAKTKGLSCG
Ga0307391_1008264713300031729MarineMTCNYLTEGCDGGWSFYHGFLGENGYLVSEKCAPYKAKTKGESCGSYGKCKPIAKIK
Ga0307387_1075709433300031737MarineMNEGCDGGWSFFHGFLAENGYMTSEQCAPYLAKTKGISCSKYTACKPVSRVED
Ga0307384_1034074623300031738MarineMNEGCDGGWPFFHGFLAEGGYLVTEECAPYLGKTKGDSCSNYA
Ga0307384_1053101213300031738MarineGCDGGWSFYHGYLGENGYLVSEKCSPYKAKTKGDTCGKYK
Ga0307383_1027100313300031739MarineMNEGCDGGWAIFHGFLAENGHMVTEKCAPYRAKTKDDKCSRYKDCPKY
Ga0307383_1030566923300031739MarineMNEGCDGGWSFFHGYLAENGFMASEQCAPYQAKTKGMACGQYKDCKPVSRIQ
Ga0307389_1047170123300031750MarineMNEGCDGGWSFFHGYLAENGYMVSEECAPYLAKTKGEKCGKYK
Ga0315899_1122625613300031784FreshwaterMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKT
Ga0315905_1134131713300032092FreshwaterLMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCSYYEKC
Ga0315334_1156998413300032360SeawaterMNEGCDGGWSFFHGYLTENGYLVDEKCAPYLAKTKGLSCG
Ga0314668_1002007353300032481SeawaterMQCNYLNEGCDGGWSFFHGYLAENGHLVTEKCAPYLAKTKG
Ga0314676_1043627313300032519SeawaterLMTCNYMNEGCDGGWSFFHGYLAENGHLVDETCAPYLGKTKGETCA
Ga0314674_1068415723300032615SeawaterMNEGCDGGWPFFHGFLAENGYLVTEECAPYKGKTKGDSCSNYENCAPHSKIVETSFIGKGYGDS
Ga0314671_1004762733300032616SeawaterMTCNYMNEGCDGGWSFFHGYLAENGHLVDETCAPYLGKTKGETCA
Ga0314671_1052410213300032616SeawaterMCNYLNEGCDGGWSFFHGFLLENGYMVSEKCAPYKAKTKGDK
Ga0314685_1035267213300032651SeawaterMNEGCDGGWAIFNGFLAENGHLVTEECAPYTARTKGHSCAQYS
Ga0314685_1049563313300032651SeawaterYLMTCNYMNEGCDGGWSFFHGYLAENGHLVDETCAPYLGKTKGETCA
Ga0314685_1064516413300032651SeawaterMTCNYLTEGCDGGWSFYHGYLGENGYLVSEKCAPYKAKTKGESCAGYGKCKPIAKIKDSYFIGGAYGESS
Ga0314687_1005167563300032707SeawaterMQCNYMNEGCDGGWSFFHGFLGENGYLVDEKCAPYLAKTKGESCGAYNKCKPISDIKESYFVG
Ga0314669_1041133623300032708SeawaterNEGCDGGWSFFHGYLAENGHLVDETCAPYLGKTKGETCA
Ga0314686_1046565213300032714SeawaterMTCNYLTEGCDGGWSFFHGYLGENGYLVSEKCAPYKAKTKGVSCGTYGKCKPM
Ga0314699_1057541213300032730SeawaterMMCNYLNEGCDGGWSFFHGFLLENGYMVSEKCAPYKAKTKGDKCKNYEHCKPI
Ga0314706_1003326723300032734SeawaterMNEGCDGGWSFFHGYLAENGHLVDETCAPYLGKTKGETCAQYEKCKPIARVHDSFFIGGAYGQSSE
Ga0314700_1008855033300032752SeawaterMNEGCDGGWSFFHGYLAENGYMVSEECAPYLAKTKGEKCSKYKKCKPISNV
Ga0335004_0283403_226_3783300034021FreshwaterMMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCAHYEKC
Ga0335037_0438094_254_4033300034107FreshwaterMCNYLNEGCDGGWSFFHGFLAENGYLVSEKCAPYKAKTKGDKCAHYEKC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.