NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077871

Metagenome Family F077871

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077871
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 47 residues
Representative Sequence MKFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRQSPGVLDGNQL
Number of Associated Samples 102
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.44 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.598 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.932 % of family members)
Environment Ontology (ENVO) Unclassified
(29.915 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.607 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.03%    β-sheet: 0.00%    Coil/Unstructured: 72.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF07690MFS_1 9.40
PF00440TetR_N 8.55
PF02567PhzC-PhzF 7.69
PF16925TetR_C_13 6.84
PF00106adh_short 2.56
PF03795YCII 1.71
PF00589Phage_integrase 1.71
PF00085Thioredoxin 1.71
PF09278MerR-DNA-bind 0.85
PF00135COesterase 0.85
PF03176MMPL 0.85
PF13460NAD_binding_10 0.85
PF13613HTH_Tnp_4 0.85
PF13683rve_3 0.85
PF02518HATPase_c 0.85
PF09339HTH_IclR 0.85
PF13374TPR_10 0.85
PF00723Glyco_hydro_15 0.85
PF12833HTH_18 0.85
PF13411MerR_1 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 7.69
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.71
COG0789DNA-binding transcriptional regulator, MerR familyTranscription [K] 0.85
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.85
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.85
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.85
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.60 %
UnclassifiedrootN/A9.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M102I86SFAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
2189573002|GZIGXIF02HJ131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii518Open in IMG/M
3300000956|JGI10216J12902_110242708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1297Open in IMG/M
3300001867|JGI12627J18819_10392289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii564Open in IMG/M
3300004081|Ga0063454_100829518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300004091|Ga0062387_101449797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300005172|Ga0066683_10426613Not Available816Open in IMG/M
3300005332|Ga0066388_108333243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005338|Ga0068868_100497675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300005364|Ga0070673_101870258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300005406|Ga0070703_10609033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans505Open in IMG/M
3300005435|Ga0070714_100264852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1592Open in IMG/M
3300005435|Ga0070714_102460482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii505Open in IMG/M
3300005437|Ga0070710_10270450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300005437|Ga0070710_10620898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300005451|Ga0066681_10994408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii500Open in IMG/M
3300005468|Ga0070707_101719081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii594Open in IMG/M
3300005530|Ga0070679_100200604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1961Open in IMG/M
3300005548|Ga0070665_100209843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1948Open in IMG/M
3300005563|Ga0068855_100545039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium1256Open in IMG/M
3300005564|Ga0070664_100963333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium801Open in IMG/M
3300005614|Ga0068856_100400330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1393Open in IMG/M
3300005713|Ga0066905_101274986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300006163|Ga0070715_10134505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium1194Open in IMG/M
3300006175|Ga0070712_101014294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii719Open in IMG/M
3300006755|Ga0079222_12542913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium514Open in IMG/M
3300006804|Ga0079221_10744352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium691Open in IMG/M
3300006854|Ga0075425_100167731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2520Open in IMG/M
3300006954|Ga0079219_10517110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300009093|Ga0105240_12589509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii524Open in IMG/M
3300009177|Ga0105248_11931829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium670Open in IMG/M
3300009700|Ga0116217_10824100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300009826|Ga0123355_11879374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii561Open in IMG/M
3300010048|Ga0126373_10659509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1102Open in IMG/M
3300010048|Ga0126373_12603978All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300010358|Ga0126370_10518393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium obuense1011Open in IMG/M
3300010360|Ga0126372_10103997All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300010360|Ga0126372_12260574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300010361|Ga0126378_11045892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia919Open in IMG/M
3300010366|Ga0126379_11209802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia862Open in IMG/M
3300010376|Ga0126381_101392193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1014Open in IMG/M
3300010396|Ga0134126_10376328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1652Open in IMG/M
3300010396|Ga0134126_12745611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii534Open in IMG/M
3300012198|Ga0137364_10541073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300012210|Ga0137378_10395662All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300012357|Ga0137384_10371753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300012361|Ga0137360_11831034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii513Open in IMG/M
3300012930|Ga0137407_11965530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii558Open in IMG/M
3300012971|Ga0126369_10552362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1217Open in IMG/M
3300012971|Ga0126369_11442238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium obuense778Open in IMG/M
3300014968|Ga0157379_11496553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii657Open in IMG/M
3300016294|Ga0182041_10306427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1318Open in IMG/M
3300016319|Ga0182033_11669772Not Available577Open in IMG/M
3300016357|Ga0182032_11509831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300016422|Ga0182039_10754978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300016445|Ga0182038_10894596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium782Open in IMG/M
3300016445|Ga0182038_12155373Not Available505Open in IMG/M
3300017924|Ga0187820_1245863Not Available573Open in IMG/M
3300017937|Ga0187809_10120275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300017946|Ga0187879_10703481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300017948|Ga0187847_10885169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii508Open in IMG/M
3300021404|Ga0210389_10405754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300021407|Ga0210383_10584522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia963Open in IMG/M
3300021479|Ga0210410_11059246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300021560|Ga0126371_13591815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300024279|Ga0247692_1077413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300025898|Ga0207692_11029809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii544Open in IMG/M
3300025915|Ga0207693_10799722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300025915|Ga0207693_10913116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii673Open in IMG/M
3300025924|Ga0207694_11523844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii564Open in IMG/M
3300025926|Ga0207659_11496775Not Available577Open in IMG/M
3300025929|Ga0207664_10963737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300026035|Ga0207703_11306236Not Available698Open in IMG/M
3300026088|Ga0207641_11958025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii587Open in IMG/M
3300027775|Ga0209177_10129565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia834Open in IMG/M
3300027787|Ga0209074_10131088All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium882Open in IMG/M
3300027882|Ga0209590_10004514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5923Open in IMG/M
3300028379|Ga0268266_10157472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2053Open in IMG/M
3300028379|Ga0268266_10222645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1735Open in IMG/M
3300028800|Ga0265338_10060982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3308Open in IMG/M
3300031543|Ga0318516_10771979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300031546|Ga0318538_10624274Not Available585Open in IMG/M
3300031549|Ga0318571_10262352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces shenzhenensis638Open in IMG/M
3300031573|Ga0310915_10586350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300031640|Ga0318555_10212952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1042Open in IMG/M
3300031668|Ga0318542_10249157All Organisms → cellular organisms → Bacteria → Terrabacteria group903Open in IMG/M
3300031682|Ga0318560_10021816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2939Open in IMG/M
3300031719|Ga0306917_10406885All Organisms → cellular organisms → Bacteria → Terrabacteria group1063Open in IMG/M
3300031719|Ga0306917_10747601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia768Open in IMG/M
3300031719|Ga0306917_10862617Not Available709Open in IMG/M
3300031747|Ga0318502_10320710Not Available913Open in IMG/M
3300031770|Ga0318521_10270600Not Available996Open in IMG/M
3300031778|Ga0318498_10171630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium986Open in IMG/M
3300031779|Ga0318566_10502217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii594Open in IMG/M
3300031782|Ga0318552_10492643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300031819|Ga0318568_10572376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300031831|Ga0318564_10103861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300031896|Ga0318551_10045178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2202Open in IMG/M
3300031912|Ga0306921_11023070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia931Open in IMG/M
3300031945|Ga0310913_11012610All Organisms → cellular organisms → Bacteria → Terrabacteria group582Open in IMG/M
3300031981|Ga0318531_10053736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. CiP31715Open in IMG/M
3300032043|Ga0318556_10647316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii551Open in IMG/M
3300032052|Ga0318506_10028356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2118Open in IMG/M
3300032052|Ga0318506_10159968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia988Open in IMG/M
3300032060|Ga0318505_10198466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium939Open in IMG/M
3300032065|Ga0318513_10304615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabichelini774Open in IMG/M
3300032074|Ga0308173_11865280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii567Open in IMG/M
3300032261|Ga0306920_102184656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii770Open in IMG/M
3300032829|Ga0335070_11294128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300032895|Ga0335074_10643967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1041Open in IMG/M
3300032954|Ga0335083_11134467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300032955|Ga0335076_10069572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3467Open in IMG/M
3300032955|Ga0335076_10304933All Organisms → cellular organisms → Bacteria → Terrabacteria group1481Open in IMG/M
3300032955|Ga0335076_10972302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii731Open in IMG/M
3300033004|Ga0335084_11647271Not Available632Open in IMG/M
3300033289|Ga0310914_11187071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300033289|Ga0310914_11382801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_042062702189573001Grass SoilMKYMLQVRFNGADTVIGRLPTEEQQNVRAEFEAIRQSSGVLDGQPAPSR
FE1_011689102189573002Grass SoilMKYLLQVRFNGADAVIGKLPAGEQEKITAEFIAIRRSP
JGI10216J12902_11024270833300000956SoilMKYMLQVRFNGADLTINELPAEQRQAIFAEFEAIGRLPG
JGI12627J18819_1039228913300001867Forest SoilMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGT
Ga0063454_10082951823300004081SoilMKYLLQIRFNGADAAIGRLPAAERQRIVAEFEAILDTPGVLDGNQLQPAGTA
Ga0062387_10144979713300004091Bog Forest SoilMKFLLQVRFNGAGAVISELPAEEQQKLTAEFEAIRRSPGVLDGNQLQAAGTA
Ga0066683_1042661313300005172SoilMKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQSAGVLDSNQL
Ga0066388_10833324323300005332Tropical Forest SoilMKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLAAAG
Ga0068868_10049767513300005338Miscanthus RhizosphereMLQVRFNGADEMIHMLPADEQEKVTAEFIAIRESSDVLDGNQL
Ga0070673_10187025823300005364Switchgrass RhizosphereMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQA
Ga0070703_1060903313300005406Corn, Switchgrass And Miscanthus RhizosphereMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGAAVTVRVSDGQA
Ga0070714_10026485213300005435Agricultural SoilMKYMLQVRFNGADAVIGGLPPDEQEKVTAEFEAIRRSPGVLDGNQLQAAN
Ga0070714_10246048213300005435Agricultural SoilMKFLLQVRFNGADKVIGTLPAEKQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATV
Ga0070710_1027045023300005437Corn, Switchgrass And Miscanthus RhizosphereMKYMLQVRFNGADAEIAKLPAAEQEKVTAEFEAVRRSPGVLDG
Ga0070710_1062089813300005437Corn, Switchgrass And Miscanthus RhizosphereMKFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRQSPGVLDGNQL
Ga0066681_1099440813300005451SoilMKFLLQVRFNGADKVIGTLAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATVR
Ga0070707_10171908113300005468Corn, Switchgrass And Miscanthus RhizosphereMKFLLQIRFNGADTMIGELPAGEQHKVTAEFEAIRQSPGV
Ga0070679_10020060413300005530Corn RhizosphereVKYMLQVRFNGADAVIRRLPADEQERLTAEFIAIRKSSGVLDGNQLEAPSSAST
Ga0070665_10020984343300005548Switchgrass RhizosphereMKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIR
Ga0068855_10054503923300005563Corn RhizosphereMKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQAA
Ga0070664_10096333323300005564Corn RhizosphereMKYLLQVRFNGADAVIGTLPAGEQEKITAEFITIRRAPGVLDGNQ
Ga0068856_10040033033300005614Corn RhizosphereVKYMLQVRFNGADAIIGRLPADEQERLTAEFIAIRKSSGVLDGNQLEAPSSASTV
Ga0066905_10127498613300005713Tropical Forest SoilMRYMIQVRFNGADAAIHLLPADEQAKITAEFQAIR
Ga0070715_1013450523300006163Corn, Switchgrass And Miscanthus RhizosphereMKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQA
Ga0070712_10101429413300006175Corn, Switchgrass And Miscanthus RhizosphereVKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSPGVLDGNQLQAA
Ga0079222_1254291323300006755Agricultural SoilMKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIRTSPGVL
Ga0079221_1074435223300006804Agricultural SoilMKYLLQIRFNGADAVIRTLPPREQEKITAEFIAIRTSPGVLDGN
Ga0075425_10016773133300006854Populus RhizosphereMKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIRTSPGVLDGNQLQAAS
Ga0079219_1051711023300006954Agricultural SoilMKYMLQVRFNGADALIGRLAAEEQQKVTAEFQAIRQFPGVLDGNQLAAAGTAA
Ga0105240_1258950933300009093Corn RhizosphereMRFLLQIRFNGADTMIGELPAEEQHKVTAEFEAIRQSPGVLDGNQLQAAS
Ga0105248_1193182923300009177Switchgrass RhizosphereMKYLLQIRFNGADAVIRTLPAGEQEKITAEFIAIR
Ga0116217_1082410023300009700Peatlands SoilMKFLLQVRFNGADKVIGALPAEDQEKVTAEFEAIRRSPGVLDGNQLQAASEAATVRV
Ga0123355_1187937413300009826Termite GutMLQVRFNGADALIGGLPAAEREKVTAEFEAIRRTAGVLDGNQ
Ga0126373_1065950923300010048Tropical Forest SoilMKYMLQVRFNGADAVIHSLPAGEQEKITAEFVAVRKSSGVLDGNQLDAAGSAKTV
Ga0126373_1260397813300010048Tropical Forest SoilMKYMLQVRFNGADVIGRLPVQEREQVTTEFEEIGRSPGVLDGNQLQA
Ga0126370_1051839323300010358Tropical Forest SoilMLQVRFDGANAVIHKLPADEQEKVTAEFIAIRKSSGVLDGNQLQAA
Ga0126372_1010399713300010360Tropical Forest SoilMKYLLQVRFNGADAVIGKLPAGEQEKITAEFIEIRRSPGVLDGNQ
Ga0126372_1226057423300010360Tropical Forest SoilMKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLA
Ga0126378_1104589213300010361Tropical Forest SoilMKYMLQVRFNGADAVIHKLPADEQEKVTAEFIAIRKS
Ga0126379_1120980213300010366Tropical Forest SoilMKYMLQVRFNGADALIGRLPAEEQQKVTAEFQAIRAFPGVLDGNQLAAAGTAAT
Ga0126381_10139219313300010376Tropical Forest SoilMKYMLQVRFNGAGALIGRLPAEEQHKVTAEFQAIRQFPGVLDGNQLAAA
Ga0134126_1037632813300010396Terrestrial SoilMLQVRFNGADKAIGELPAGDQEKVTAEFKEVRRSAGVLDGNQL
Ga0134126_1274561113300010396Terrestrial SoilMQGDRVKYMLQVRFNGADAVIGGLPAAEQEKVTAEFEAIRRSAGVLDGNQLQAAA
Ga0137364_1054107313300012198Vadose Zone SoilMKFLLQVRFNGADTMISELPAEEQHKVTAEFEAIRQSP
Ga0137378_1039566213300012210Vadose Zone SoilMKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSSGVLDGNQLQAASTA
Ga0137384_1037175333300012357Vadose Zone SoilMKFLLQVRFNGAGNVIGDLPAEEQQKVTAEFEAIRQSSGVLDGNQLQAAGTAVTVRVEG
Ga0137360_1183103413300012361Vadose Zone SoilMKFLLQVRFNGAGNVIGELPSEEQQKVTAEFEAIRQSSGVLDGNQ
Ga0137407_1196553023300012930Vadose Zone SoilMKFLLQVRFNGADNVIGELPAEEQQKVTAEFEEIRQSSGVL
Ga0126369_1055236213300012971Tropical Forest SoilMKYMLQVRFNGADTVMGRLSAEEQQNVRAEFEAVRQSSGVLDGNQLQATTQVELVEIG*
Ga0126369_1144223823300012971Tropical Forest SoilMLQIRFNGADAVIHKLPADEQEKVTAEFIAIRKSSGVLDG
Ga0157379_1149655323300014968Switchgrass RhizosphereMKFMLQVRFNGADKAIGELSAGDQQKVTAEFEEIRRSPGVLDGNQLQAAGTAATVRVDGRQP
Ga0182041_1030642713300016294SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQLQAAGTAATVR
Ga0182033_1166977213300016319SoilVKYMLQVRFNGADAVIAKLPAGEQEKVTAEFIAIRK
Ga0182032_1150983113300016357SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQLQAASGAATVRVH
Ga0182039_1075497823300016422SoilMKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGNQLQAAGTAATVRLD
Ga0182038_1089459613300016445SoilMTYLLQVRFNGADEVIHKLSADEQEKITAEFVAIRKSSGVLDGNQLEAAST
Ga0182038_1215537313300016445SoilMKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQS
Ga0187820_124586313300017924Freshwater SedimentVKYMLQVRFNGADAAIGRLPADEQEKITAEFEAIRRYPG
Ga0187809_1012027523300017937Freshwater SedimentVKYMLQVRFNGADEVIRKLPADEQEKVTADFIAIRESSGVLDGNQL
Ga0187879_1070348113300017946PeatlandMEFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIRRSPGVLDGYQLQAASTA
Ga0187847_1088516923300017948PeatlandMEFLLQVRFNGADNVIGELPAEEQQKVTAEFEAIR
Ga0210389_1040575413300021404SoilMKFLLQVRFNGADKVIGTLPAEEQKRVTGEFEAIRRSPGVLDGNQLQAAGTAA
Ga0210383_1058452223300021407SoilMKFLLQVRFNGADKVIGALPAEEQKKVTGEFEAIRETSGVLDGNQLQAASE
Ga0210410_1105924613300021479SoilMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAGTAATVRVD
Ga0126371_1359181513300021560Tropical Forest SoilVKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSSGVLDGNQLQAASTAAT
Ga0247692_107741323300024279SoilMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQ
Ga0207692_1102980913300025898Corn, Switchgrass And Miscanthus RhizosphereVKFMLQIRFNGADKAIGGLPAAEQEKVTAEFEAIRRSPGVLDGNQLQAVGTASTVRV
Ga0207693_1079972233300025915Corn, Switchgrass And Miscanthus RhizosphereMKFLLQVRFDGADKVIGTLPAEEQKRVTGEFEAIRRSPGVLDGNQLQAAG
Ga0207693_1091311613300025915Corn, Switchgrass And Miscanthus RhizosphereVKFMLQVRFNGADKAIGELSAGDQEKVTAEFEEIRRSPGVLDGNQLQAASTAATV
Ga0207694_1152384413300025924Corn RhizosphereMKYMLQVRFNGADTVIGRLSAGEQQNVRAEFEAIRQSPGVLDGNKLQAASTAAT
Ga0207659_1149677513300025926Miscanthus RhizosphereVKYMLQVRFNGADEMIHMLPADEQEKVTAEFIAIRESSDVLDGNQLQAA
Ga0207664_1096373713300025929Agricultural SoilMKFLLQVRFNGAGTVIGALPAEEQKKVTGEFEAIRRSPGVLDG
Ga0207703_1130623623300026035Switchgrass RhizosphereMKFMLQVRFNGADKAIGELSAGDQQKVTAEFEEIRRSPGVLDGNQLQAAGTAATVR
Ga0207641_1195802513300026088Switchgrass RhizosphereMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLD
Ga0209177_1012956533300027775Agricultural SoilMKFLLQVRFNGADKVIGTLPAEEQKQVTGEFEAIRRSPGVLDGNQLQAAG
Ga0209074_1013108813300027787Agricultural SoilVKYLLQVRFNGAEAVIHELPADEQEKVTAEFIAIRKSPGVLDGNQLEAPG
Ga0209590_1000451483300027882Vadose Zone SoilMKYMLQVRFNGADAAIGRLPADEQQKVTAEFEAIRRSPGVLDGNQL
Ga0268266_1015747213300028379Switchgrass RhizosphereMKYLLQVRFNGADAVIGTLPAGEQEKITAEFIAIRRSPGVLDGNQLQAAGAAVTVRVS
Ga0268266_1022264533300028379Switchgrass RhizosphereVKYMLQVRFNGADAIIDRLPADEQERLTAEFIAIRKSSGVLDGN
Ga0265338_1006098243300028800RhizosphereMKFLLQVRFNGADKVIGALPAADQQKVTDEFIAVRQSPGVLDGNQLQAASE
Ga0318516_1077197923300031543SoilMKYMLQVRFNGADALIGRLPAEEQHKVTAEFQAIRQFPGVLDG
Ga0318538_1062427423300031546SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIR
Ga0318571_1026235223300031549SoilMKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQSS
Ga0310915_1058635013300031573SoilMKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGNQLQAA
Ga0318555_1021295213300031640SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGNQ
Ga0318542_1024915723300031668SoilMKYMLQVRFNGADTLIGTLPAEEQQKVTAEFQVIRQFPG
Ga0318560_1002181653300031682SoilVKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAA
Ga0306917_1040688523300031719SoilMKYMLQVRFNGADALIGTLPAEEQQKVTAEFQVIRQFPGVLDGNQLAAAGTA
Ga0306917_1074760123300031719SoilMKYMLQVRFNGAGALIGRLPAAEQQKVTAEFQAIRHSPGVLDGNQL
Ga0306917_1086261713300031719SoilVKYMLQVRFNGVDEVIHKLPADDQEKVTAEFIAIRESSGVLDGNQ
Ga0318502_1032071023300031747SoilVKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLD
Ga0318521_1027060013300031770SoilVKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAATVRVHGG
Ga0318498_1017163013300031778SoilMTYLLQVRFNGADEVIHKLPADEQEKVTAEFVAIRKSSGVLDGNQLEAASA
Ga0318566_1050221713300031779SoilMKYMLQVRFNGADALIGTLPAEEQQKVTAEFQVIRQFPGVLDGNQLAAAGTAATVRV
Ga0318552_1049264313300031782SoilMKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRW
Ga0318568_1057237623300031819SoilMKYMLQVRFNGADIVIGRLSAREQQDVRAEFEAIRQSSGVLDGSQLQAASTA
Ga0318564_1010386113300031831SoilMKFMLQVRFNGAETVISELPAEEQQKVTAEFEAIRWSPGVLDGN
Ga0318551_1004517813300031896SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQ
Ga0306921_1102307023300031912SoilMKYMLQVRFNGAGALIGRLPAAEQQTVTAEFQAIRHSPGVLDGNQ
Ga0310913_1101261013300031945SoilVKYMLQVRFNGVDEVIHKLPADEQEKVTAEFIAIRKSSGVLDGSQLQAA
Ga0318531_1005373633300031981SoilVKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRK
Ga0318556_1064731623300032043SoilMKYMLQVRFNGADALIGTLPADEQQKLTAEFQAIRQFPGVLDGNQLAAADTAATV
Ga0318506_1002835613300032052SoilVKYMLQVRFDGADAVIGKLPAGEQEKVTAEFIAIRKSSGVLDGSQLQAASGAATVRE
Ga0318506_1015996823300032052SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDGN
Ga0318505_1019846613300032060SoilVKYMLQVRFNGADAAIGRLPADEQEKITAEFEAIRRSPGVLDGNQLQAAS
Ga0318513_1030461513300032065SoilMKFLLQVRFNGAGHVIGELPVGEQQKVTAEFEAIRQSPGVLDGNQLQAA
Ga0308173_1186528023300032074SoilVKFLLQVRFNGADTVIGELPAEERQKVTGEFIAIRSSVGVLGGN
Ga0306920_10218465613300032261SoilMKFLLQVRFNGAGHVIGELPAGEQQKVTAEFEAIRQSPGVLDANQLQAAGTAATVCM
Ga0335070_1129412813300032829SoilMKYMLQVRFNGADIVIGRLSAREQQHVRAEFEAIRQSSGVLDGSQLQVA
Ga0335074_1064396713300032895SoilMKYMLQVRFNGADAAIGRLPADEQAKITGEFEAIRRSPGVLDGN
Ga0335083_1113446713300032954SoilMKFLLQVRFNGAGAVIGALPAGEQQKVTAEFEAIRQSPGVLDDNQLQAA
Ga0335076_1006957213300032955SoilMKYMLQVRFNGADTVIGRLSAEEQQNVRAEFEAIRQ
Ga0335076_1030493313300032955SoilVKYMLQVRFNGADEVIRKLPAGEREKVTAEFIAIRESS
Ga0335076_1097230213300032955SoilVKYMLQVRFNGADAVIGGLPADEQEKITAEFEAIRQSP
Ga0335084_1164727113300033004SoilMKYVLQVRFNGADTVIGSLSAKEQQNVHAEFEAIRQSP
Ga0310914_1118707123300033289SoilMKFMLQVRFNGADTVISELPAEEQQKVTAEFEAIR
Ga0310914_1138280123300033289SoilMKYMLQVRFNGADIVIGRLSAREQQDVRAEFEAIRQSSGVL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.