NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077770

Metagenome / Metatranscriptome Family F077770

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077770
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 42 residues
Representative Sequence AVAKPIPDAPADIIIFLFFNDWLTINYDFVNEDCNSLLVI
Number of Associated Samples 111
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 90.60 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.342 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(21.367 % of family members)
Environment Ontology (ENVO) Unclassified
(52.991 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.744 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.00%    β-sheet: 5.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00005ABC_tran 63.25
PF00528BPD_transp_1 12.82
PF01925TauE 0.85
PF13561adh_short_C2 0.85
PF04069OpuAC 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.34 %
UnclassifiedrootN/A19.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10039486All Organisms → cellular organisms → Bacteria2196Open in IMG/M
3300001352|JGI20157J14317_10196787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter579Open in IMG/M
3300001353|JGI20159J14440_10113324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria836Open in IMG/M
3300001946|GOS2244_1013711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria922Open in IMG/M
3300002040|GOScombined01_105608861Not Available972Open in IMG/M
3300003185|JGI26064J46334_1063879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria697Open in IMG/M
3300004279|Ga0066605_10216546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter729Open in IMG/M
3300006166|Ga0066836_10139904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1420Open in IMG/M
3300006166|Ga0066836_10222507Not Available1123Open in IMG/M
3300006402|Ga0075511_1157212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1431Open in IMG/M
3300006404|Ga0075515_10125824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter2199Open in IMG/M
3300007116|Ga0101667_1017908Not Available1157Open in IMG/M
3300014030|Ga0116816_1008772Not Available981Open in IMG/M
3300014973|Ga0134293_1036610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300016731|Ga0182094_1132480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300016733|Ga0182042_1044533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria883Open in IMG/M
3300016736|Ga0182049_1218286Not Available1085Open in IMG/M
3300016742|Ga0182052_1382094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1532Open in IMG/M
3300016754|Ga0182072_1297873Not Available1164Open in IMG/M
3300016771|Ga0182082_1620496Not Available1104Open in IMG/M
3300017713|Ga0181391_1104877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria638Open in IMG/M
3300017714|Ga0181412_1121436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300017740|Ga0181418_1078026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300017749|Ga0181392_1202257Not Available570Open in IMG/M
3300017752|Ga0181400_1052401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1262Open in IMG/M
3300017755|Ga0181411_1164076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300017759|Ga0181414_1112103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria716Open in IMG/M
3300017781|Ga0181423_1057302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1550Open in IMG/M
3300017782|Ga0181380_1022812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2322Open in IMG/M
3300017824|Ga0181552_10491946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300017950|Ga0181607_10303350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria896Open in IMG/M
3300018417|Ga0181558_10658012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300018426|Ga0181566_10280567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1210Open in IMG/M
3300018876|Ga0181564_10668303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300019281|Ga0182077_1327583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria815Open in IMG/M
3300019459|Ga0181562_10132699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1374Open in IMG/M
3300020013|Ga0182086_1257062Not Available1072Open in IMG/M
3300020054|Ga0181594_10480921Not Available507Open in IMG/M
3300020166|Ga0206128_1090884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1346Open in IMG/M
3300020261|Ga0211534_1050607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300020281|Ga0211483_10176211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300020311|Ga0211628_1053288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria660Open in IMG/M
3300020314|Ga0211522_1032775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria945Open in IMG/M
3300020377|Ga0211647_10047260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1593Open in IMG/M
3300020388|Ga0211678_10327357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300020396|Ga0211687_10066874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1574Open in IMG/M
3300020438|Ga0211576_10645209Not Available523Open in IMG/M
3300020446|Ga0211574_10344555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria644Open in IMG/M
3300020462|Ga0211546_10300430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria803Open in IMG/M
3300020465|Ga0211640_10246099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria999Open in IMG/M
3300020468|Ga0211475_10415525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria651Open in IMG/M
3300020468|Ga0211475_10565862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria540Open in IMG/M
3300020470|Ga0211543_10084026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1639Open in IMG/M
3300021347|Ga0213862_10023966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2269Open in IMG/M
3300021373|Ga0213865_10395592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria615Open in IMG/M
3300021378|Ga0213861_10432329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300021379|Ga0213864_10241661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria917Open in IMG/M
3300021389|Ga0213868_10384014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria781Open in IMG/M
3300021957|Ga0222717_10368040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria803Open in IMG/M
3300021960|Ga0222715_10489969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria654Open in IMG/M
3300022900|Ga0255771_1302470Not Available520Open in IMG/M
(restricted) 3300022920|Ga0233426_10167538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria920Open in IMG/M
3300022928|Ga0255758_10301331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria681Open in IMG/M
(restricted) 3300022933|Ga0233427_10429548Not Available527Open in IMG/M
3300022937|Ga0255770_10426198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300022939|Ga0255754_10500978Not Available518Open in IMG/M
3300023115|Ga0255760_10520409Not Available517Open in IMG/M
3300023116|Ga0255751_10114965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1645Open in IMG/M
(restricted) 3300024264|Ga0233444_10034421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique3276Open in IMG/M
3300024297|Ga0228658_1081399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria809Open in IMG/M
3300024301|Ga0233451_10137287Not Available1139Open in IMG/M
3300024322|Ga0228656_1017095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1674Open in IMG/M
(restricted) 3300024324|Ga0233443_1057556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1615Open in IMG/M
3300024328|Ga0228635_1088871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria727Open in IMG/M
3300024329|Ga0228631_1075566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria846Open in IMG/M
3300024329|Ga0228631_1085893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria770Open in IMG/M
3300024420|Ga0228632_1133663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300024428|Ga0233396_1006039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique4497Open in IMG/M
3300025643|Ga0209151_1160353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300025666|Ga0209601_1152009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria646Open in IMG/M
3300025712|Ga0209305_1030764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter1996Open in IMG/M
3300025806|Ga0208545_1065724Not Available1027Open in IMG/M
3300025809|Ga0209199_1242963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300025881|Ga0209309_10294106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300026085|Ga0208880_1096291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria637Open in IMG/M
3300026407|Ga0247589_1067202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300026453|Ga0228644_1059409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300026458|Ga0247578_1067960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria689Open in IMG/M
3300026479|Ga0228622_1068508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria776Open in IMG/M
3300026503|Ga0247605_1126026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300027048|Ga0208962_1050478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300027280|Ga0208972_1007968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3078Open in IMG/M
3300027501|Ga0208948_1035686Not Available1066Open in IMG/M
3300027572|Ga0208964_1082612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300027847|Ga0209402_10258489Not Available1106Open in IMG/M
3300027906|Ga0209404_10052620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2309Open in IMG/M
3300028109|Ga0247582_1056393Not Available1026Open in IMG/M
3300028115|Ga0233450_10376298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300028127|Ga0233401_1090565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria708Open in IMG/M
3300028131|Ga0228642_1086133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300028132|Ga0228649_1016700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2139Open in IMG/M
3300028174|Ga0257123_1010461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique3213Open in IMG/M
3300028196|Ga0257114_1280381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300028197|Ga0257110_1089471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1300Open in IMG/M
3300028197|Ga0257110_1196266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300028273|Ga0228640_1077192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300028279|Ga0228613_1077374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300028396|Ga0228643_1012205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique2318Open in IMG/M
3300028397|Ga0228639_1034082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1540Open in IMG/M
3300031766|Ga0315322_10144136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique1698Open in IMG/M
3300031773|Ga0315332_10486396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300031774|Ga0315331_10320866Not Available1140Open in IMG/M
3300031774|Ga0315331_10635469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300031774|Ga0315331_10958386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300031851|Ga0315320_10530033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300032088|Ga0315321_10313894Not Available996Open in IMG/M
3300032360|Ga0315334_10513505Not Available1027Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater21.37%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh19.66%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.68%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.69%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater6.84%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.13%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.42%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.71%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.71%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.71%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.71%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.85%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001946Marine microbial communities from North James Bay, Santigo Island, EquadorEnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300003185Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007116Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3EnvironmentalOpen in IMG/M
3300014030Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300014973Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubationEnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020054Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020261Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556096-ERR598970)EnvironmentalOpen in IMG/M
3300020281Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)EnvironmentalOpen in IMG/M
3300020311Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171)EnvironmentalOpen in IMG/M
3300020314Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300022939Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaGEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025643Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m (SPAdes)EnvironmentalOpen in IMG/M
3300025666Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026085Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes)EnvironmentalOpen in IMG/M
3300026407Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 49R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027048Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_80 (SPAdes)EnvironmentalOpen in IMG/M
3300027280Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027501Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028174Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_135EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300028397Seawater microbial communities from Monterey Bay, California, United States - 50DEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1003948613300000117MarineQILTVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI*
JGI20157J14317_1019678713300001352Pelagic MarineHILTVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI*
JGI20159J14440_1011332423300001353Pelagic MarineLAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI*
GOS2244_101371123300001946MarineLAVAKPIPDAPAEIIIFLFFNDLLTINYDFVNDVCNSLLDI*
GOScombined01_10560886113300002040MarineIPDAPAEIIIFLFFNDLLTINYDFVNDVCNSLLDI*
JGI26064J46334_106387913300003185MarineAPRERHNLAVAKPIPDAPAEIIIFLFFNDLLTINYDFVKDDCNSLLDI*
Ga0066605_1021654623300004279MarineVYQLQSFDLLARQTFAVAKPIPDASADKIIFLFFNDWLTINYDFVNEDCNSLFVI*
Ga0066836_1013990413300006166MarinePDAPAEIIIFLFFNDWLTINYDFVKDDCNSLLDI*
Ga0066836_1022250723300006166MarineAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI*
Ga0075511_115721233300006402AqueousLERQILTVAKPIPDAPADIIIFLFFNDWLIINYDFVNEDCNSLLVI*
Ga0075515_1012582413300006404AqueousIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM*
Ga0101667_101790823300007116Volcanic Co2 Seep SeawaterPDAPAEMIIFLFFNDWLTINYDFVKDDCNSLLDI*
Ga0116816_100877223300014030MarineRHNLAVAKPIPDAPAEIIIFLFFNDWLTINYDFVKDDCNSLLDI*
Ga0134293_103661023300014973MarineQILTVAKTIPDEPADIIIFLFFNDWLTINYDFVKDS*
Ga0182094_113248023300016731Salt MarshPLERHTFAVARPIPNAPADIMIFLFFNDWLTINYVFVNEDCNSLLVM
Ga0182042_104453313300016733Salt MarshRHTFAVARPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0182049_121828623300016736Salt MarshFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0182052_138209413300016742Salt MarshAPLERHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0182072_129787323300016754Salt MarshPLERHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0182082_162049613300016771Salt MarshTVAPLERHTFAVARPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0181391_110487713300017713SeawaterIPDPPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0181412_112143613300017714SeawaterTRQTFAVAKPIPDAPADIIIFLFVNDLLTINYDFVNDDCNSLLVI
Ga0181418_107802613300017740SeawaterTVAPLARQTFAVAKPIPDAPADIMIFLFFNDLLTINYDFVNDDCNSLLVI
Ga0181392_120225723300017749SeawaterVAPLERQILTVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0181400_105240113300017752SeawaterARPIPDAPADMMTFLFFNDWLTINYDFVNEDCNSLLVI
Ga0181411_116407613300017755SeawaterNPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0181414_111210313300017759SeawaterAVAKPIPDPPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0181423_105730213300017781SeawaterKPIPDAPADIMIFLFFNDWLTINYDFVNDDCNSLLVI
Ga0181380_102281213300017782SeawaterPLARQIFAVAKPIPDAPADMIIFLFFNDWLIINYDFVNEDCNSLLVI
Ga0181552_1049194613300017824Salt MarshPLERHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0181607_1030335013300017950Salt MarshHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0181558_1065801223300018417Salt MarshPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0181566_1028056733300018426Salt MarshMNTIAPLSRHTFAVAHPITDAPAEIIIFLFFHDXLTINYDFVK
Ga0181564_1066830313300018876Salt MarshRPIPDAPADMIIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0182077_132758313300019281Salt MarshPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0181562_1013269933300019459Salt MarshPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLFVI
Ga0182086_125706223300020013Salt MarshPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0181594_1048092113300020054Salt MarshRARHILAVAKPIPDAPAEIIIFLFFNDWLTINYDFVSDVCSSLFDI
Ga0206128_109088413300020166SeawaterVAPLERHTFAVARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0211534_105060723300020261MarineAVAKPIPDAPAEIIIFLFFNDWLTINYDFVKDDCNSLLDI
Ga0211483_1017621123300020281MarinePRARHNLAVAKPIPDAPAEMIIFLFFNDWLTINYDFVKDDCNSLLDI
Ga0211628_105328823300020311MarinePIPDAPADIIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0211522_103277513300020314MarineARHNLAVAKPIPDAPAEMIIFLFFNDWLTINYDFVKDDCNSLLDI
Ga0211647_1004726013300020377MarineIPDAPADIIIFLFFNDWLIINYDFVNDDCSSLLVI
Ga0211678_1032735723300020388MarineARQTFAVAKPIPDAPADIIIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0211687_1006687413300020396MarineTVAPLARQIFAVAKPIPDAPADKIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0211576_1064520923300020438MarineTFAVAKPIPDAPAEIIILLFFNDWLTINYDFVKDD
Ga0211574_1034455513300020446MarineKPIPDAPAEIIIFLFFNDWLTINYDFVKDDCNSLLDI
Ga0211546_1030043013300020462MarineTFAVAKPIPDAPADIIIFLFFNDLLIINYDFVNEDCNSLLVI
Ga0211640_1024609913300020465MarineYAPLDNKIFVVAHPIPDAPADIIIFLFFRDWLVITYDLVSEVSNSLFVI
Ga0211475_1041552513300020468MarineVANPIPDAPADMIIFLFFNDWLTINYDLVNDDCNSLLVI
Ga0211475_1056586223300020468MarineAKPIPDAPAEIIIFLFFNDLLTINYDFVNDVCNSLLDI
Ga0211543_1008402613300020470MarineKPIPDAPAEIIIFLFFNDLLTINYDFVNDVCNSLLDI
Ga0213862_1002396613300021347SeawaterHTFTVAKPIPDAPADIIIFLSFNDWLTINYDFVNDDCNSLFVI
Ga0213865_1039559213300021373SeawaterPLERHTFAVARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0213861_1043232923300021378SeawaterILAVANPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0213864_1024166123300021379SeawaterAVARPIPDAPADMMIFLFFNDWLTINYDLVNEDCNSLLVM
Ga0213868_1038401413300021389SeawaterIPDAPADIIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0222717_1036804013300021957Estuarine WaterPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0222715_1048996913300021960Estuarine WaterAAPLERHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0255771_130247023300022900Salt MarshVKYFFSISHIKTVAPLVRQTLVVAQPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLLV
(restricted) Ga0233426_1016753823300022920SeawaterIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0255758_1030133123300022928Salt MarshLARHIFAVAKPIPDAPADMIIFLFFNDWLTINYDFVNDDCNSLLVI
(restricted) Ga0233427_1042954823300022933SeawaterPLERQILTVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0255770_1042619813300022937Salt MarshPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0255754_1050097823300022939Salt MarshARPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0255760_1052040923300023115Salt MarshVAPLERHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0255751_1011496513300023116Salt MarshARHILAVAKPIPDAPAEIIIFLFFNDWLTINYDFVSDVCSSLFDI
(restricted) Ga0233444_1003442113300024264SeawaterQLQSFDLLARQTFAVAKPIPDACTDKIIFLFFNDWLTINYDFVNEDCNSLFVI
Ga0228658_108139913300024297SeawaterFAVAKPIPDAPADIMIFLFFNDWLTINYDFVNDDCNSLLVI
Ga0233451_1013728723300024301Salt MarshRHTFAVARPIPDAPADMIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228656_101709513300024322SeawaterFAVAKPIPDAPADIIIFLFFNDWLTINYDFVNDDCNSLLVI
(restricted) Ga0233443_105755633300024324SeawaterARQIFAVAKPIPDAPADIIIFLFFNDWLTINYDFINEDCNSLLVI
Ga0228635_108887123300024328SeawaterTVAPLERHTFAVAKPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228631_107556613300024329SeawaterVAKPIPEAPADIIIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0228631_108589313300024329SeawaterKPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0228632_113366313300024420SeawaterIFVVARPIPDAPADIMTFLFFNDWLTINYDFVNEDCNSLLVI
Ga0233396_100603913300024428SeawaterTFAVARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0209151_116035323300025643MarineSLAADQPIPEAPAEIIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0209601_115200913300025666Pelagic MarineAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0209305_103076433300025712Pelagic MarineARQTLAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0208545_106572423300025806AqueousPLARQTLAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0209199_124296323300025809Pelagic MarineRQILTVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0209309_1029410613300025881Pelagic MarineQTLAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0208880_109629123300026085MarineRARHNLAVAKPIPDAPAEIIIFLFFNDWLTINYDFVKDDCNSLLDI
Ga0247589_106720213300026407SeawaterIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228644_105940913300026453SeawaterAVARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0247578_106796023300026458SeawaterKPIPDAPADMTIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228622_106850813300026479SeawaterPLERHIFVVARPIPDAPADIIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0247605_112602613300026503SeawaterARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0208962_105047813300027048MarineFAVAKPIPDASADKIIFLFFNDWLTINYDFVNEDCNSLFVI
Ga0208972_100796843300027280MarineLARQTFAVAKPIPDAPAEIIILLFFNDWLTINYDFVKDD
Ga0208948_103568613300027501MarinePLARQTFAVAKPIPDAPADIMIFLFFNDLLTINYDFVNDDCNSLLVI
Ga0208964_108261213300027572MarineAPLARQTFAVAKPIPDAPAEIIILLFFNDWLTINYDFVKDD
Ga0209402_1025848923300027847MarineAHPIPDAPADITIFLFLRDWLVITYDLVSEVSNSLFVI
Ga0209404_1005262013300027906MarineVAKPIPDAPADIIIFLFFNDWLTINYDFVNDDCNSLLVI
Ga0247582_105639323300028109SeawaterVPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0233450_1037629813300028115Salt MarshLARHTFAMAKPIPDAPADIIIFLFFNDWLTINYDFVNDDCNSLFVI
Ga0233401_109056513300028127SeawaterPIPDPPADIMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228642_108613313300028131SeawaterVAPLERHTFAVAKPIPDAPADMMIFLFFNDWLTINYDFVNDDCNSLLVM
Ga0228649_101670033300028132SeawaterAVAKPIPDAPADIMIFLFFNDWLTINYDFVNDDCNSLLVI
Ga0257123_101046113300028174MarineLARQTFAVAKPIPDASADKIIFLFFNDWLTINYDFVNEDCNSLFVI
Ga0257114_128038113300028196MarineKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0257110_108947113300028197MarinePIPDAPADNIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0257110_119626623300028197MarineAPLARQIFAVAKPIPDAPADKIIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228640_107719213300028273SeawaterFAVARPIPDAPADMMIFLFFNDWLIINYDFVNEDCNSLLVM
Ga0228613_107737413300028279SeawaterHTFAVAKPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0228643_101220543300028396SeawaterRQIFAVAKPIPDAPADMIIFLFFNDWLIINYDFVNEDCNSLLVI
Ga0228639_103408213300028397SeawaterPIPDAPADIMIFLFFNDLLTINYDFVNDDCNSLLVI
Ga0315322_1014413613300031766SeawaterAVAKPIPDAPADIIIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0315332_1048639623300031773SeawaterVAPLERHIFVVARPIPDAPADMMTFLFFNDWLTINYDFVNEDCNSLLVI
Ga0315331_1032086613300031774SeawaterALLARQTLAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0315331_1063546913300031774SeawaterRPIPDAPADMMTFLFFNDWLTINYDFVNEDCNSLLVI
Ga0315331_1095838623300031774SeawaterTFAIAKPIPEAPADIMIFLFFNDWLTINYDFVNDDCNSLLVI
Ga0315320_1053003313300031851SeawaterHTFAVARPIPDAPADMMIFLFFNDWLTINYDFVNEDCNSLLVM
Ga0315321_1031389423300032088SeawaterFAVAKPIPDAPADIMIFLFFNDWLTINYDFVNEDCNSLLVI
Ga0315334_1051350513300032360SeawaterRNSLAADQPIPEAPAEIIIFLFFNDWLTINYDFVNEDCNSLLVM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.