NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077755

Metagenome Family F077755

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077755
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 40 residues
Representative Sequence MITDVNPFVYSRPISPEEIVDRDDETEQLLKNAVGGHY
Number of Associated Samples 103
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.86 %
% of genes near scaffold ends (potentially truncated) 98.29 %
% of genes from short scaffolds (< 2000 bps) 94.02 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.744 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.821 % of family members)
Environment Ontology (ENVO) Unclassified
(32.479 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.718 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.73%    β-sheet: 0.00%    Coil/Unstructured: 77.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF08241Methyltransf_11 9.40
PF01256Carb_kinase 7.69
PF05014Nuc_deoxyrib_tr 3.42
PF00248Aldo_ket_red 2.56
PF00166Cpn10 2.56
PF04011LemA 1.71
PF02410RsfS 1.71
PF00486Trans_reg_C 1.71
PF13361UvrD_C 1.71
PF13541ChlI 1.71
PF07676PD40 1.71
PF00842Ala_racemase_C 1.71
PF00072Response_reg 0.85
PF13191AAA_16 0.85
PF08811DUF1800 0.85
PF00582Usp 0.85
PF01168Ala_racemase_N 0.85
PF13489Methyltransf_23 0.85
PF13302Acetyltransf_3 0.85
PF01315Ald_Xan_dh_C 0.85
PF01471PG_binding_1 0.85
PF13581HATPase_c_2 0.85
PF04237YjbR 0.85
PF00067p450 0.85
PF07642BBP2 0.85
PF00082Peptidase_S8 0.85
PF12681Glyoxalase_2 0.85
PF00679EFG_C 0.85
PF07883Cupin_2 0.85
PF01266DAO 0.85
PF07508Recombinase 0.85
PF01458SUFBD 0.85
PF06155GBBH-like_N 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0063NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domainNucleotide transport and metabolism [F] 7.69
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 7.69
COG3613Nucleoside 2-deoxyribosyltransferaseNucleotide transport and metabolism [F] 3.42
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 2.56
COG0787Alanine racemaseCell wall/membrane/envelope biogenesis [M] 1.71
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 1.71
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 1.71
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 0.85
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.85
COG2124Cytochrome P450Defense mechanisms [V] 0.85
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.85
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.85
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.74 %
UnclassifiedrootN/A10.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725002|GPICC_F5MS3JC01EWDBFAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
2124908044|A5_c1_ConsensusfromContig2362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
2140918007|ConsensusfromContig3140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium986Open in IMG/M
2228664021|ICCgaii200_c0250087Not Available616Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11112424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1301Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11113999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1283Open in IMG/M
3300000890|JGI11643J12802_10537158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300000890|JGI11643J12802_11683387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1984Open in IMG/M
3300005168|Ga0066809_10130149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales639Open in IMG/M
3300005339|Ga0070660_101882872All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005339|Ga0070660_101948010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300005436|Ga0070713_100464174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300005471|Ga0070698_101646640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300005543|Ga0070672_101545473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300005544|Ga0070686_101156606Not Available641Open in IMG/M
3300005564|Ga0070664_101968293All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300005575|Ga0066702_10657611All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium626Open in IMG/M
3300005587|Ga0066654_10658439Not Available584Open in IMG/M
3300005615|Ga0070702_100878739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300005615|Ga0070702_101594988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300005719|Ga0068861_101230976Not Available725Open in IMG/M
3300005764|Ga0066903_104506633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300005843|Ga0068860_101256329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300005844|Ga0068862_101361939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300006046|Ga0066652_100126558All Organisms → cellular organisms → Bacteria → Terrabacteria group2107Open in IMG/M
3300006169|Ga0082029_1352599All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300006178|Ga0075367_10039887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2740Open in IMG/M
3300006358|Ga0068871_100302009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1405Open in IMG/M
3300006755|Ga0079222_10127852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1398Open in IMG/M
3300006844|Ga0075428_101996283All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300009098|Ga0105245_10780349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium993Open in IMG/M
3300009174|Ga0105241_10117099All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300009176|Ga0105242_11703640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides soli667Open in IMG/M
3300009840|Ga0126313_10019215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4516Open in IMG/M
3300010038|Ga0126315_10878600Not Available595Open in IMG/M
3300010371|Ga0134125_10219565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2113Open in IMG/M
3300010379|Ga0136449_102680015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300010399|Ga0134127_12041356All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300010403|Ga0134123_10241431All Organisms → cellular organisms → Bacteria → Terrabacteria group1566Open in IMG/M
3300012200|Ga0137382_10459001Not Available902Open in IMG/M
3300012208|Ga0137376_11626854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300012361|Ga0137360_11789147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300012490|Ga0157322_1036621All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300012958|Ga0164299_10717383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300012961|Ga0164302_10161939All Organisms → cellular organisms → Bacteria → Terrabacteria group1331Open in IMG/M
3300012984|Ga0164309_10155486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1526Open in IMG/M
3300013297|Ga0157378_12541488Not Available564Open in IMG/M
3300013503|Ga0120127_10074430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300013772|Ga0120158_10135762All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1391Open in IMG/M
3300014823|Ga0120170_1085863All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300015372|Ga0132256_101453864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300015372|Ga0132256_102003101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300015374|Ga0132255_100498452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1789Open in IMG/M
3300015374|Ga0132255_101702689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium957Open in IMG/M
3300017789|Ga0136617_11492424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300018031|Ga0184634_10103746Not Available1244Open in IMG/M
3300018032|Ga0187788_10356937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300018060|Ga0187765_11185395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300018073|Ga0184624_10333711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides soli679Open in IMG/M
3300018073|Ga0184624_10510436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300018476|Ga0190274_10487637All Organisms → cellular organisms → Bacteria1227Open in IMG/M
3300019867|Ga0193704_1051703All Organisms → cellular organisms → Bacteria → Terrabacteria group802Open in IMG/M
3300019884|Ga0193741_1159638All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300021953|Ga0213880_10178006Not Available591Open in IMG/M
3300022694|Ga0222623_10136417Not Available956Open in IMG/M
3300023071|Ga0247752_1016618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1028Open in IMG/M
3300023097|Ga0247757_10153539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300024055|Ga0247794_10006648All Organisms → cellular organisms → Bacteria2551Open in IMG/M
3300024290|Ga0247667_1072292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300025764|Ga0209539_1097041All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300025864|Ga0209429_10265081All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300025916|Ga0207663_10258341All Organisms → cellular organisms → Bacteria → Terrabacteria group1285Open in IMG/M
3300025920|Ga0207649_11581282All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium519Open in IMG/M
3300025924|Ga0207694_10996105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M
3300025927|Ga0207687_10030319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3646Open in IMG/M
3300025928|Ga0207700_10259398All Organisms → cellular organisms → Bacteria → Terrabacteria group1488Open in IMG/M
3300025928|Ga0207700_11139260Not Available697Open in IMG/M
3300025934|Ga0207686_10334583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli1135Open in IMG/M
3300025937|Ga0207669_10163547All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300025937|Ga0207669_10403026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300025944|Ga0207661_11863664All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025945|Ga0207679_11314421All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300026035|Ga0207703_11840198All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300026067|Ga0207678_11470882All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300026089|Ga0207648_10198115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1781Open in IMG/M
3300026317|Ga0209154_1243291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia634Open in IMG/M
3300026785|Ga0207496_100632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1022Open in IMG/M
3300027725|Ga0209178_1040842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes1475Open in IMG/M
3300027842|Ga0209580_10620054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300027873|Ga0209814_10537403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300027897|Ga0209254_10576424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300028589|Ga0247818_11206385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300028592|Ga0247822_10883505Not Available733Open in IMG/M
3300028592|Ga0247822_11748429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300028597|Ga0247820_11064713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300028705|Ga0307276_10159206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300028755|Ga0307316_10388356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300028771|Ga0307320_10194378All Organisms → cellular organisms → Bacteria → Terrabacteria group792Open in IMG/M
3300028799|Ga0307284_10216601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300028807|Ga0307305_10050709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1912Open in IMG/M
3300028807|Ga0307305_10190275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium944Open in IMG/M
3300028811|Ga0307292_10158521All Organisms → cellular organisms → Bacteria → Terrabacteria group917Open in IMG/M
3300028811|Ga0307292_10415206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300028812|Ga0247825_11218942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300028885|Ga0307304_10429994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300028889|Ga0247827_10469497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300028889|Ga0247827_11117869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300031525|Ga0302326_10442533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1996Open in IMG/M
3300031525|Ga0302326_10535440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1763Open in IMG/M
3300031548|Ga0307408_101253125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300031564|Ga0318573_10795429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300032001|Ga0306922_10661235All Organisms → cellular organisms → Bacteria → Terrabacteria group1103Open in IMG/M
3300032013|Ga0310906_10803048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300032173|Ga0315268_11488899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300032174|Ga0307470_11811511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300032892|Ga0335081_12037750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300032955|Ga0335076_10782345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium mangrovi836Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.56%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.71%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.85%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.85%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.85%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.85%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023097Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L126-311R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025864Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026785Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICC_028474902067725002SoilMIRDVNPFVYSRPVAPEDVVDREAEVRSLLHHAVGGHYVR
A5_c1_005535102124908044SoilVITDVNPFVYSRPISPEEIVDRDEETQQLLQCAVGGHYVRLY
A_all_C_001574602140918007SoilVITDVNPFVYSRPISPDEIIDRDEETQQLLQNAVGGHYVRLY
ICCgaii200_025008722228664021SoilMITDINPFVYSRPIAPDQIVDRDDETHALLKNAVGGHYVRLR
ICChiseqgaiiFebDRAFT_1111242413300000363SoilMITDINPFVYSRPIAPDQIVDRDEETRALLKNAVGGHY
ICChiseqgaiiFebDRAFT_1111399913300000363SoilMITDINPFVYSRPIAPDQIVDRDDETHALLKNAVGGHY
JGI11643J12802_1053715813300000890SoilMIRDINPFVYSRPVSPEDVVDREAEVRSLLHDAVGGHY
JGI11643J12802_1168338743300000890SoilMITDVNPFVYSRPISPEEIVDRDDETQQLLKHAVG
Ga0066809_1013014933300005168SoilMITDVNPFIYSHPLAPDDIIDRDDETRELLTAAVGGHYVRLYAPRKYG
Ga0070660_10188287223300005339Corn RhizosphereVITDVNPFIYSRPIEPDQIVDRDEETQALLKNAVGGHYVR
Ga0070660_10194801023300005339Corn RhizosphereMLADINPFVYSHPLAPDEIIDRDEETRELLSHAVGGHYVR
Ga0070713_10046417433300005436Corn, Switchgrass And Miscanthus RhizosphereMLTDTNPFIYSHPIAPDDVIDRDAETEQLLTAAVGGHFVRLYAPRKYGKTS
Ga0070698_10164664013300005471Corn, Switchgrass And Miscanthus RhizosphereMIRDINPFVYSRPVSPEDVVDREAEVRSLLHDAVGGHYVRLYA
Ga0070672_10154547323300005543Miscanthus RhizosphereVITDVNPFVYSRPIEPDQVVDRDDETEALLKNAVG
Ga0070686_10115660613300005544Switchgrass RhizosphereMLVDVNPFVYSHPLGPGEIIDRDRETTELLANAVGGHFTRLY
Ga0070664_10196829333300005564Corn RhizosphereMITDVNPFIYSHPLAPDDIIDRDDETRELLTAAVGGHYVRLYAPRKY
Ga0066702_1065761123300005575SoilVITDVNPFIYSHPVDPEDVIDRDEETEKLLAQVVGGHFVRLYAPRKYGKTS
Ga0066654_1065843923300005587SoilVLTDTNPFIYSHPIAPDDVIDRDAETGQLLAAAVGGHFVRL
Ga0070702_10087873923300005615Corn, Switchgrass And Miscanthus RhizosphereMITDVNPFVYSRPVAPEDVVDREDEVRRLLRDAVGGHYVRLYA
Ga0070702_10159498823300005615Corn, Switchgrass And Miscanthus RhizosphereVITDVNPFVYSRPIEPDQVVDRDDETEALLKNAVGGHYVRLYA
Ga0068861_10123097623300005719Switchgrass RhizosphereMITDVNPFIYSHPIAPEDVIDRDEETKRLLTAAVGGHFVRL
Ga0066903_10450663323300005764Tropical Forest SoilMITDVNPFVYSRPVAPEDVVDREDEVRRLLRDAVGGHY
Ga0068860_10125632913300005843Switchgrass RhizosphereLIVDVNPFVYSRPVAPEDVVDREDEVRRLLRDAVGGHYVRLY
Ga0068862_10136193923300005844Switchgrass RhizosphereVITDANPFIYSRPIPPEDLIDRDNEAAELLRAAVGGHY
Ga0066652_10012655843300006046SoilMLTDTNPFIYSHPIAPDDVIDRDEETAKLLQWAVGGHYVRLFA
Ga0082029_135259913300006169Termite NestMLGDGNPFVYSRPVAPEDVIDRERETEELLRLAIG
Ga0075367_1003988713300006178Populus EndosphereMIRDINPFVYSRPVSPEDVVDREAEVRSLLHDAVGGHYV
Ga0068871_10030200933300006358Miscanthus RhizosphereMVRFVGTVITDVNPFVYSHPIAPDDVIDRDDETRELLDAAIGG
Ga0079222_1012785223300006755Agricultural SoilVLIDANPFIYSHPVAPDDVIDRDAETEQLLAAAVGGHFVRLYAPRKYGKTS
Ga0075428_10199628333300006844Populus RhizosphereVITDVNPFVYSRPIGPEDVIDRDDETRKLLTSAVGGHY
Ga0105245_1078034933300009098Miscanthus RhizosphereMIQDVNPFVYSRPVPPEDVVDRDAEVADLLQHAVGG
Ga0105241_1011709913300009174Corn RhizosphereLFPHHLVRYFRTVLTDPNPFIYSHPIAPDDVIDRDAETRQLLAAAVGGHFVRLYAPRK
Ga0105242_1170364023300009176Miscanthus RhizosphereMITDVNPFVYSRPISPEEIVDRDDETEQLLKNAVGGHYVRL
Ga0126313_1001921513300009840Serpentine SoilMITDVNPFIYSHPLSPEEIIDRNEETQELLRNVVGGHFVRLFAPRKYGKT
Ga0126315_1087860013300010038Serpentine SoilMGAMITDVNPFVYSHPVAAEDVIDRDAETQALLKDVVGGHFVR
Ga0134125_1021956533300010371Terrestrial SoilLVRYFRTMLTDTNPFIYSHPIAPDDVIDRDAETEQLLTAAVGGHFVRLY
Ga0136449_10268001513300010379Peatlands SoilMPALDVNPFIYSHPLSPEDVIDRDDETGALLQNALGGHYVRL
Ga0134127_1204135633300010399Terrestrial SoilMLTDINPFVYSHPLAPDEIIDRDDETHELLAQAVGG
Ga0134123_1024143113300010403Terrestrial SoilVITDVNPFIYSRPIEPDQIVARDEGTQALRKDAVGGHYVRL
Ga0137382_1045900123300012200Vadose Zone SoilMITDVNPFIYSHPVAPEDIIDRDEETMELLRNAVGGHFVRLFAPRKYG
Ga0137376_1162685423300012208Vadose Zone SoilVADVNPFVYSRPLAPEDVLDREPEVKQLLALAAGGHYVRLY
Ga0137360_1178914723300012361Vadose Zone SoilVITDINPFVYSRPISPDEVIDRDDETHRLLQWAVGGHFV
Ga0157322_103662113300012490Arabidopsis RhizosphereMVRWLGTVITDVNPFVYSRPLAPDDIIDRDEETHRLLTAAVGGHYVRLY
Ga0164299_1071738323300012958SoilVITDVNPFVYSRPIEPDQIVDRDEETLALLKNAVGGHYVR
Ga0164302_1016193913300012961SoilMLTDINPFIYSHPLAPDEIIDRDDETRALLEHAVGGHYV
Ga0164309_1015548613300012984SoilVITDVNPFVYSRPIEPEQIVDRDEETQALLRHAVG
Ga0157378_1254148823300013297Miscanthus RhizosphereMITDVNPFIYSHPIAPEDVIDRDEETKRLLTAAVGGHFVRLYA
Ga0120127_1007443013300013503PermafrostMPRMIQIDKTVIDQINPFIYSHPVEPEDVIDRDGETRKLLADVIGGHYVRLYAPRKY
Ga0120158_1013576223300013772PermafrostVITDVNPFIYSHPVDPEDVIDRDEETEKLLAQVVGGHFVRL
Ga0120170_108586313300014823PermafrostMITDVNPFIYSHPVDPEDVIDRDEETEKLLAQVVGGHFVRLYAPRKYGKT
Ga0132256_10145386413300015372Arabidopsis RhizosphereMIQDVNPFVYSRPVPPEDVVDRDAEVADLLQHAVGGHYV
Ga0132256_10200310123300015372Arabidopsis RhizosphereMIEDVNPFVYSRPVPPEDVVDRDAEVADLLQHAVGG
Ga0132255_10049845223300015374Arabidopsis RhizosphereVITDVNPFVYSRPIEPEQIIDRDEETQALLRHAVG
Ga0132255_10170268923300015374Arabidopsis RhizosphereVITDVNPFIYSRPIEPDQIVDRDEETQALLKTAVGGH
Ga0136617_1149242413300017789Polar Desert SandMINDLNPFVYSHPLAAEDVIDRDDETHELLKKAIGG
Ga0184634_1010374623300018031Groundwater SedimentMITDVNPFVYSRPISPEEIVDRDDETEQLLKNAVG
Ga0187788_1035693713300018032Tropical PeatlandVADANPFVYSRPVAPEDVLDREDEIAQLLSLAAGGHYV
Ga0187765_1118539513300018060Tropical PeatlandMLAAVSASTNPFVYSRPVSPDEVVDREEEVAQLLRWAAGGHYV
Ga0184624_1033371123300018073Groundwater SedimentMITDINPFVYSRPISPEEIVNRDDETEQLLKNAVGG
Ga0184624_1051043613300018073Groundwater SedimentMITDVNPFIYSHPLSPDDIIDRDEETQQLLTAAVGGHYVRLY
Ga0190274_1048763713300018476SoilMIVDVNPFVYSRPVPPEDIVDREDEVRQLLRNAVGGH
Ga0193704_105170323300019867SoilMITDVNPFIYSRPISPEEIVDRDDETQQLLKHAVGGHYV
Ga0193741_115963813300019884SoilMITDVNPFVYSHPLDPEDVIDRDEEARELLTHAVGGHFVRL
Ga0213880_1017800613300021953Exposed RockMIEDVNPFVYSRPIDPEDILDRDEETRELLKRAVGGHYVR
Ga0222623_1013641713300022694Groundwater SedimentMITDINPFVYSHPVAAEDVIDRDAETQELLKNVVG
Ga0247752_101661813300023071SoilMITDVNPFVYSRPIAPDQIVDRDEETQLLLKNAVG
Ga0247757_1015353913300023097Plant LitterMIVDVNPFVYSRPVPPEDVVDRDAEVADLLRHAVGG
Ga0247794_1000664813300024055SoilMITDVNPFVYSRPVAPEDVVDREDEVRRLLRDAVGG
Ga0247667_107229223300024290SoilVADVNPFVYSRPVAPENVLDREPEIRQLLSLASGGHY
Ga0209539_109704113300025764Arctic Peat SoilMITDVNPFVYSRPIPPDDVIDRDDETRELLRKIVGGH
Ga0209429_1026508123300025864Arctic Peat SoilMITDVNPFVYSRPIPPDDVIDRDDETRELLRKVVGGHYVRL
Ga0207663_1025834123300025916Corn, Switchgrass And Miscanthus RhizosphereVITDVNPFVYSRPIEPEQIVDRDEETQALLRHAVGGHYV
Ga0207649_1158128213300025920Corn RhizosphereVITDTNPFFYSRPIGPEDIIDRDEETAKLLQWAVGGHYVRL
Ga0207694_1099610523300025924Corn RhizosphereMLTDANPFIYSHPIAPDDVIDRDPETEQLLAAAVGGHFVR
Ga0207687_1003031953300025927Miscanthus RhizosphereMLTDTNPFIYSHPIAPDDVIDRDAETGQLLAAAVGGHFVRLYAPRKYGK
Ga0207700_1025939843300025928Corn, Switchgrass And Miscanthus RhizosphereMLTDTNPFIYSHPIAPDDVIDRDAETEQLLTAAVGGHFVRLYAPRKYG
Ga0207700_1113926023300025928Corn, Switchgrass And Miscanthus RhizosphereMLVDVNPFVYSHPLGPGEIIDRDRETTELLANAVGGHF
Ga0207686_1033458313300025934Miscanthus RhizosphereLIVDVNPFVYSRPVAPEDVVDREDEVRRLLRDAVG
Ga0207669_1016354733300025937Miscanthus RhizosphereMIQDVNPFVYSRPVPPEDVVDRDAEVADLLQHAVGGHY
Ga0207669_1040302623300025937Miscanthus RhizosphereVITDVNPFVYSRPIEPDQIVDRDEETLALLKNAVGGHY
Ga0207661_1186366413300025944Corn RhizosphereVITDVNPFVYSHPLSPEDIVDRDDETRELLRNVVG
Ga0207679_1131442113300025945Corn RhizosphereVITDVNPFVYSRPIEPDQVVDRDDETEALLKNAVGGHYVRLY
Ga0207703_1184019813300026035Switchgrass RhizosphereVITDVNPFVYSRPIEPDQIVDRDEETLALLKNAVGGHYVRLYA
Ga0207678_1147088213300026067Corn RhizosphereVITDVNPFVYSRPIEPDQIVDRDEETLALLKNAVG
Ga0207648_1019811533300026089Miscanthus RhizosphereMIEDVNPFVYSRPVPPEDVVDRDEEVEALLRSAVGG
Ga0209154_124329123300026317SoilVITDVNPFIYSHPVDPEDVIDRDEETEKLLAQVVGGHFV
Ga0207496_10063213300026785SoilMITDVNPFVYSRPIAPDQIVDRDEETQLLLKNAVGGH
Ga0209178_104084233300027725Agricultural SoilMLTDTNPFIYSHPIAPDDVIDRDAETGQLLAAAVGGHFVRLYA
Ga0209580_1062005413300027842Surface SoilVIDQVNPFIYSHPVEPEDVIDRDDETRKLLADAVGGHFVRL
Ga0209814_1053740313300027873Populus RhizosphereMITDVNPFVYSRPIAPDQIVDRDEETQLLLKNAVGGHYV
Ga0209254_1057642413300027897Freshwater Lake SedimentMPITDVNPFVYSHPLVPDDIIDRDEETEQLLRNVVGGH
Ga0247818_1120638513300028589SoilMIVDVNPFVYSRPVPPEDIVDREDEVRQLLRNVVGGHYVRLY
Ga0247822_1088350513300028592SoilMITDVNPFVYSRPISPEEIVDRDDETEQLLKNAVGGHY
Ga0247822_1174842913300028592SoilVIEDVNPFVYSRPVPPEDVVDRDEDVRQLLRSAVGGHY
Ga0247820_1106471313300028597SoilMIVDVNPFVYSRPVPPEDIVDRDDEVRLLLRHAIGGHY
Ga0307276_1015920623300028705SoilVADVNPFVYSRPLAPEDVLDREPEIEQLLSLAAGGH
Ga0307316_1038835613300028755SoilVAGDINPFVYSRPVAPEDVLDREPEIRQLLSLAGGG
Ga0307320_1019437813300028771SoilMITDVNPFVYSRPISPEEIVDRDDETQQLLKHAVGGHYVRLY
Ga0307284_1021660123300028799SoilVADVNPFVYSRPLAPEDVLDREPEIAQLLSLAAGGH
Ga0307305_1005070913300028807SoilMITDINPFVYSRPIAPEQIVDRDEETQLLLKNAVG
Ga0307305_1019027513300028807SoilMITDVNPFVYSHPVSAEEVIDRDGETQELLRNAVGGHFVRLYA
Ga0307292_1015852113300028811SoilMITDVNPFVYSRPISPEEIVDRDDETQQLLKHAVGGHY
Ga0307292_1041520613300028811SoilVAGDINPFVYSRPVAPEDVLGREPEIRQLLSLAGGGHYVRHYA
Ga0247825_1121894233300028812SoilVIVQTNPFVYSRPLSPEDVIDRDAEVGELLRLAVGGHY
Ga0307304_1042999413300028885SoilVAGDINPFVYSRPVAPEDVLGREPEIRQLLSLAGGGHNVRRY
Ga0247827_1046949713300028889SoilVIVQTNPFVYSRPLSPEDVIDRDAEVGELLRLAVAERPP
Ga0247827_1111786923300028889SoilMIVDVNPFVYSRPVAPEDVVDREDEVRQLLRNVVGGHY
Ga0302326_1044253313300031525PalsaVLDANPFIYSHPLGPEDIINRDGETQALLQNAVGGHYVRLFA
Ga0302326_1053544043300031525PalsaMITDVNPFVYSHPLAPEDIIDRDQETHDLLANAVGGHYV
Ga0307408_10125312513300031548RhizosphereMIRDVNPFVYSRPVAPEDVVDREAEVRSLLHHAVGGHYVRLYDP
Ga0318573_1079542913300031564SoilLSTDLIEDVNPFVYSRPISPADLVDRHGETHELLTKAVGGHYV
Ga0306922_1066123523300032001SoilVITDANPFVYSRPIPPEDLIDRDPEAADLLRAAVGGHY
Ga0310906_1080304813300032013SoilMITDVNPFVYSHPVSAEEVIDRDGETQELLRNAVGGHFVR
Ga0315268_1148889913300032173SedimentMPITDVNPVVYSHPLVPDDIIDRDEETEQLLRNVVGGHYVRLYAPRKYGK
Ga0307470_1181151113300032174Hardwood Forest SoilVIDDINPFIYSHPVEPEDVIDRDDETRKLLADAVGGHFVR
Ga0335081_1203775023300032892SoilMIDVNPFVYSHPVAPEDVIDRDEETDTLLRNAVGG
Ga0335076_1078234513300032955SoilMIEDVNPFVYSRPISPEEILDRDAETHDLLKSAVG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.