NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077741

Metagenome / Metatranscriptome Family F077741

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077741
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 46 residues
Representative Sequence MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Number of Associated Samples 94
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 61.54 %
% of genes near scaffold ends (potentially truncated) 49.57 %
% of genes from short scaffolds (< 2000 bps) 84.62 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.487 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere
(9.402 % of family members)
Environment Ontology (ENVO) Unclassified
(54.701 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(60.684 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 73.33%    β-sheet: 0.00%    Coil/Unstructured: 26.67%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00313CSD 37.61
PF13419HAD_2 15.38
PF15919HicB_lk_antitox 4.27
PF00687Ribosomal_L1 4.27
PF05685Uma2 4.27
PF02894GFO_IDH_MocA_C 3.42
PF01408GFO_IDH_MocA 3.42
PF02604PhdYeFM_antitox 1.71
PF03681Obsolete Pfam Family 1.71
PF04563RNA_pol_Rpb2_1 0.85
PF00497SBP_bac_3 0.85
PF16320Ribosomal_L12_N 0.85
PF00873ACR_tran 0.85
PF13442Cytochrome_CBB3 0.85
PF00162PGK 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0081Ribosomal protein L1Translation, ribosomal structure and biogenesis [J] 4.27
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 4.27
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 3.42
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.71
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.71
COG0085DNA-directed RNA polymerase, beta subunit/140 kD subunitTranscription [K] 0.85
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.49 %
UnclassifiedrootN/A20.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004479|Ga0062595_100810714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae773Open in IMG/M
3300004631|Ga0058899_11955623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium513Open in IMG/M
3300004635|Ga0062388_100762158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae912Open in IMG/M
3300004803|Ga0058862_10145291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae749Open in IMG/M
3300005327|Ga0070658_10006657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia9363Open in IMG/M
3300005327|Ga0070658_11618962All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005330|Ga0070690_100298964All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300005336|Ga0070680_100388653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1188Open in IMG/M
3300005337|Ga0070682_101775278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae537Open in IMG/M
3300005338|Ga0068868_100072685All Organisms → cellular organisms → Bacteria2744Open in IMG/M
3300005344|Ga0070661_100752147Not Available797Open in IMG/M
3300005458|Ga0070681_10098162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2875Open in IMG/M
3300005459|Ga0068867_100826652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae828Open in IMG/M
3300005534|Ga0070735_10492365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae730Open in IMG/M
3300005535|Ga0070684_100573529All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005539|Ga0068853_102313985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae521Open in IMG/M
3300005548|Ga0070665_100209588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1949Open in IMG/M
3300005563|Ga0068855_100125822All Organisms → cellular organisms → Bacteria2930Open in IMG/M
3300005563|Ga0068855_101544626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium680Open in IMG/M
3300005564|Ga0070664_100765964Not Available901Open in IMG/M
3300005564|Ga0070664_101237799All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005577|Ga0068857_101143504All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300005577|Ga0068857_101798427Not Available600Open in IMG/M
3300005614|Ga0068856_101711171All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005718|Ga0068866_10585371All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005841|Ga0068863_100367379All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300005843|Ga0068860_100719951All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006047|Ga0075024_100105556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1240Open in IMG/M
3300006052|Ga0075029_100331123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium978Open in IMG/M
3300006052|Ga0075029_100916086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium602Open in IMG/M
3300006172|Ga0075018_10031532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2118Open in IMG/M
3300006237|Ga0097621_100356205All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300006354|Ga0075021_10526896All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300006638|Ga0075522_10052464All Organisms → cellular organisms → Bacteria2353Open in IMG/M
3300006638|Ga0075522_10096477Not Available1609Open in IMG/M
3300006640|Ga0075527_10120163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae733Open in IMG/M
3300006881|Ga0068865_100760271All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009011|Ga0105251_10501547All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009093|Ga0105240_12393881Not Available547Open in IMG/M
3300009098|Ga0105245_10585343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1141Open in IMG/M
3300009148|Ga0105243_10094032Not Available2475Open in IMG/M
3300009174|Ga0105241_10601638All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300009176|Ga0105242_10221213All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300009176|Ga0105242_10321285Not Available1420Open in IMG/M
3300009176|Ga0105242_11634901Not Available679Open in IMG/M
3300009176|Ga0105242_12458535Not Available569Open in IMG/M
3300009551|Ga0105238_12166223Not Available590Open in IMG/M
3300009551|Ga0105238_12915999Not Available514Open in IMG/M
3300010373|Ga0134128_12661330All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300011120|Ga0150983_11586823Not Available647Open in IMG/M
3300011120|Ga0150983_12716069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium580Open in IMG/M
3300011120|Ga0150983_16661422Not Available790Open in IMG/M
3300012212|Ga0150985_103888906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium664Open in IMG/M
3300012362|Ga0137361_10889472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium808Open in IMG/M
3300012924|Ga0137413_11834828Not Available501Open in IMG/M
3300012931|Ga0153915_11843015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium708Open in IMG/M
3300012989|Ga0164305_11345965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium626Open in IMG/M
3300013104|Ga0157370_10868962Not Available819Open in IMG/M
3300013296|Ga0157374_11412845All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300013308|Ga0157375_11053233Not Available951Open in IMG/M
3300013832|Ga0120132_1054067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium782Open in IMG/M
3300014159|Ga0181530_10387909All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300014167|Ga0181528_10392111Not Available756Open in IMG/M
3300014325|Ga0163163_10118101All Organisms → cellular organisms → Bacteria2684Open in IMG/M
3300014325|Ga0163163_11897709All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300014657|Ga0181522_10524899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium714Open in IMG/M
3300014838|Ga0182030_10256176All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300014968|Ga0157379_10263443All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300015195|Ga0167658_1023296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1703Open in IMG/M
3300015203|Ga0167650_1015509All Organisms → cellular organisms → Bacteria → Acidobacteria2125Open in IMG/M
3300016728|Ga0181500_1148356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium567Open in IMG/M
3300017792|Ga0163161_10964950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium726Open in IMG/M
3300018468|Ga0066662_11369476All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300019256|Ga0181508_1460484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium578Open in IMG/M
3300020076|Ga0206355_1138419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium602Open in IMG/M
3300022532|Ga0242655_10260394All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025862|Ga0209483_1141437Not Available1009Open in IMG/M
3300025862|Ga0209483_1259091Not Available668Open in IMG/M
3300025899|Ga0207642_10324533All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300025903|Ga0207680_10208028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1336Open in IMG/M
3300025909|Ga0207705_10064044Not Available2657Open in IMG/M
3300025912|Ga0207707_10146252All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300025912|Ga0207707_10493240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1045Open in IMG/M
3300025913|Ga0207695_10314900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1455Open in IMG/M
3300025917|Ga0207660_10633901All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025921|Ga0207652_11749309All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025927|Ga0207687_10563962All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300025927|Ga0207687_10688322All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300025927|Ga0207687_11371198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium608Open in IMG/M
3300025931|Ga0207644_10404422Not Available1116Open in IMG/M
3300025931|Ga0207644_11267989All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300025934|Ga0207686_10418023All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300025934|Ga0207686_11077595All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025949|Ga0207667_10119485All Organisms → cellular organisms → Bacteria2716Open in IMG/M
3300026023|Ga0207677_11905383Not Available552Open in IMG/M
3300026078|Ga0207702_11670573All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300026088|Ga0207641_11905090All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026089|Ga0207648_10050390All Organisms → cellular organisms → Bacteria → Acidobacteria3641Open in IMG/M
3300026116|Ga0207674_10050448All Organisms → cellular organisms → Bacteria4251Open in IMG/M
3300027894|Ga0209068_10266309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium956Open in IMG/M
3300027898|Ga0209067_10529994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium671Open in IMG/M
3300027915|Ga0209069_10503607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium682Open in IMG/M
3300027986|Ga0209168_10164657Not Available1120Open in IMG/M
3300028379|Ga0268266_10025380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5041Open in IMG/M
3300028381|Ga0268264_11680315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria645Open in IMG/M
3300028800|Ga0265338_10933317All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300030923|Ga0138296_1416332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium665Open in IMG/M
3300030923|Ga0138296_1516032All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300030923|Ga0138296_1804403Not Available527Open in IMG/M
3300031234|Ga0302325_10139274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4384Open in IMG/M
3300031234|Ga0302325_10470507All Organisms → cellular organisms → Bacteria1916Open in IMG/M
3300031740|Ga0307468_100444166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1008Open in IMG/M
3300032174|Ga0307470_10149487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41426Open in IMG/M
3300032515|Ga0348332_14173072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium708Open in IMG/M
3300033412|Ga0310810_10161619All Organisms → cellular organisms → Bacteria2587Open in IMG/M
3300033412|Ga0310810_10431895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1344Open in IMG/M
3300033475|Ga0310811_10267232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2006Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere9.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere7.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere6.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.13%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.42%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.71%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.71%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.85%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062595_10081071423300004479SoilMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0058899_1195562323300004631Forest SoilMSKTCGDMARFNRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA*
Ga0062388_10076215823300004635Bog Forest SoilMSKTCGDTARFHRLRKQKINRRARNRTLQAEIAARKAEKAANPVALKPAA*
Ga0058862_1014529123300004803Host-AssociatedMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKTASAAASKPAA*
Ga0070658_1000665773300005327Corn RhizosphereMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA*
Ga0070658_1161896213300005327Corn RhizosphereCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0070690_10029896433300005330Switchgrass RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0070680_10038865333300005336Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA*
Ga0070682_10177527813300005337Corn RhizosphereMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA*
Ga0068868_10007268543300005338Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0070661_10075214713300005344Corn RhizosphereRFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA*
Ga0070681_1009816223300005458Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV*
Ga0068867_10082665233300005459Miscanthus RhizosphereIVMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0070735_1049236533300005534Surface SoilMSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKAAKP
Ga0070684_10057352913300005535Corn RhizospherePVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0068853_10231398513300005539Corn RhizosphereMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAA
Ga0070665_10020958813300005548Switchgrass RhizosphereCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0068855_10012582253300005563Corn RhizosphereMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0068855_10154462633300005563Corn RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTA*
Ga0070664_10076596413300005564Corn RhizosphereSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA*
Ga0070664_10123779913300005564Corn RhizosphereSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0068857_10114350413300005577Corn RhizosphereRKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV*
Ga0068857_10179842723300005577Corn RhizosphereFHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA*
Ga0068856_10171117123300005614Corn RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKASKPAA*
Ga0068866_1058537113300005718Miscanthus RhizosphereFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0068863_10036737923300005841Switchgrass RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIATRKAEKATKPAA*
Ga0068860_10071995113300005843Switchgrass RhizosphereRAFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA*
Ga0075024_10010555633300006047WatershedsMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA*
Ga0075029_10033112323300006052WatershedsMSKTCGDTARFHRIRKQKINRRAKNRLLQAEIAARKAEKAAKPAA*
Ga0075029_10091608623300006052WatershedsGDTARFHRIRKQKINRRAKNRILQAEIAVRKAEKAANASALKPAA*
Ga0075018_1003153263300006172WatershedsSSTKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA*
Ga0097621_10035620523300006237Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA*
Ga0075021_1052689633300006354WatershedsTARFHRIRKQTINRRAKNRILQAEIAARKAEKAVKPAA*
Ga0075522_1005246443300006638Arctic Peat SoilMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPPA*
Ga0075522_1009647713300006638Arctic Peat SoilCGDTARFHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA*
Ga0075527_1012016323300006640Arctic Peat SoilMSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKAAKPAA*
Ga0068865_10076027123300006881Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINKRARIRELQAAIAAKKAAAEPKPAA*
Ga0105251_1050154713300009011Switchgrass RhizosphereRAFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0105240_1239388113300009093Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPTA*
Ga0105245_1058534323300009098Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRALQAEISARKAANGEKAKPAA*
Ga0105243_1009403243300009148Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPTA*
Ga0105241_1060163813300009174Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPA
Ga0105242_1022121313300009176Miscanthus RhizosphereKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA*
Ga0105242_1032128523300009176Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKATKPAA*
Ga0105242_1163490113300009176Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTAKPAA*
Ga0105242_1245853513300009176Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAANGEKAKPAA*
Ga0105238_1216622313300009551Corn RhizosphereRLRKEKVMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA*
Ga0105238_1291599913300009551Corn RhizosphereRKEKVMSKSCGDTARFHRIRKQKINRRAKNRILQSEIAARKAEKAAKPAA*
Ga0134128_1266133023300010373Terrestrial SoilMSKTGGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0150983_1158682323300011120Forest SoilMSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAANPIALKPAA*
Ga0150983_1271606923300011120Forest SoilMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKSAKPAA*
Ga0150983_1666142213300011120Forest SoilMSKTCGDTARFHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA*
Ga0150985_10388890623300012212Avena Fatua RhizosphereMSKTCGDTARFHRLRKQKINRRARNRELQAEIAARKAAAADKAKPAA*
Ga0137361_1088947213300012362Vadose Zone SoilKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAATTEKSKPAA*
Ga0137413_1183482823300012924Vadose Zone SoilMSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAATAVALKPAA*
Ga0153915_1184301533300012931Freshwater WetlandsMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA*
Ga0164305_1134596513300012989SoilSTKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA*
Ga0157370_1086896223300013104Corn RhizosphereVRKQKINRRAMNRTLQAEIAARKAEKTAGAAASKPAA*
Ga0157374_1141284513300013296Miscanthus RhizosphereKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAAHKAEKAAKPAA*
Ga0157375_1105323313300013308Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTT*
Ga0120132_105406723300013832PermafrostMSKTCGDTARFHRIRKQKINRRARNRALQAEIAARKAEKAAKPAA*
Ga0181530_1038790923300014159BogMSKTCGDTARFHRLRKQRIANRMKVRALRAAIAAKKAAEPPKPAA*
Ga0181528_1039211123300014167BogMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAVKAASAVALKPAA*
Ga0163163_1011810173300014325Switchgrass RhizosphereAFPVSRKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV*
Ga0163163_1189770913300014325Switchgrass RhizosphereRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA*
Ga0181522_1052489913300014657BogMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKSA
Ga0182030_1025617633300014838BogMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAVKAASAVALKPAA*
Ga0157379_1026344333300014968Switchgrass RhizosphereMSKTCGDTARFHRICKQKINRRAKNRILQAEIAARKAEKAAKPAA*
Ga0167658_102329623300015195Glacier Forefield SoilMSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAATALALKPAA*
Ga0167650_101550943300015203Glacier Forefield SoilSTKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANTEKAKPAA*
Ga0181500_114835613300016728PeatlandMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARK
Ga0163161_1096495023300017792Switchgrass RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAESAARKAEKAAKPA
Ga0066662_1136947623300018468Grasslands SoilMSKTCGDTARFHRLRKQKIARRARNRALQAEIAERKAAANAEKSKPAA
Ga0181508_146048423300019256PeatlandMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKA
Ga0206355_113841933300020076Corn, Switchgrass And Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKT
Ga0242655_1026039413300022532SoilRVLMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0209483_114143733300025862Arctic Peat SoilMSKSCGDTARFHRLRKQKIRMRMRVRELKAAIAERTATADPAKPKA
Ga0209483_125909123300025862Arctic Peat SoilFHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA
Ga0207642_1032453313300025899Miscanthus RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA
Ga0207680_1020802823300025903Switchgrass RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0207705_1006404433300025909Corn RhizosphereMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA
Ga0207707_1014625223300025912Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV
Ga0207707_1049324023300025912Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA
Ga0207695_1031490043300025913Corn RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTA
Ga0207660_1063390113300025917Corn RhizosphereIPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA
Ga0207652_1174930923300025921Corn RhizosphereAFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV
Ga0207687_1056396213300025927Miscanthus RhizosphereTARFHRLRKQKINKRARIRELQAAIAAKKAAAEPKPAA
Ga0207687_1068832223300025927Miscanthus RhizosphereMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA
Ga0207687_1137119813300025927Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRALQAEISARKAANGEKAKPAA
Ga0207644_1040442233300025931Switchgrass RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAK
Ga0207644_1126798913300025931Switchgrass RhizosphereARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0207686_1041802333300025934Miscanthus RhizosphereMSKTCGDTARFHRLRKQKINKRARIRELQAAIAAKKAAAEP
Ga0207686_1107759523300025934Miscanthus RhizosphereFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA
Ga0207667_1011948543300025949Corn RhizosphereMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0207677_1190538313300026023Miscanthus RhizosphereTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTT
Ga0207702_1167057323300026078Corn RhizosphereMSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKASKPAA
Ga0207641_1190509023300026088Switchgrass RhizosphereARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA
Ga0207648_1005039013300026089Miscanthus RhizosphereTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA
Ga0207674_1005044853300026116Corn RhizosphereMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAA
Ga0209068_1026630913300027894WatershedsMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA
Ga0209067_1052999423300027898WatershedsMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAGKPAA
Ga0209069_1050360713300027915WatershedsMSKTCGDTARFHRIRKQRINMRARVRALRAEIALKNANKTVVATDA
Ga0209168_1016465743300027986Surface SoilPLRKEKVMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKTAGAAASKPAA
Ga0268266_1002538083300028379Switchgrass RhizosphereARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0268264_1168031523300028381Switchgrass RhizosphereFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA
Ga0265338_1093331713300028800RhizosphereKVMSKTCGDTARFHRLRKQKINRRAKNRMLQAEIAARKAEKAAKPAA
Ga0138296_141633223300030923SoilMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAVRKAEKSRQARSVEV
Ga0138296_151603223300030923SoilARFHRLRKQKINRRARNRALQAEIAARKAEKTATAVTLKPAA
Ga0138296_180440323300030923SoilGDTARFHRLRKQKIARRARNRALQAEIAARKAATTEKSKPAA
Ga0302325_1013927423300031234PalsaMSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAANPVALNPAA
Ga0302325_1047050723300031234PalsaMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAVKAASAVALKPAA
Ga0307468_10044416623300031740Hardwood Forest SoilMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTANASALKPAA
Ga0307470_1014948723300032174Hardwood Forest SoilMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTAKPAA
Ga0348332_1417307213300032515Plant LitterMSKTCGDTARFHRLRKQKIAKRTKIRELRAAVEARNEAKKAAAPQPA
Ga0310810_1016161913300033412SoilMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKA
Ga0310810_1043189543300033412SoilKVMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA
Ga0310811_1026723243300033475SoilKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.