Basic Information | |
---|---|
Family ID | F077741 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 46 residues |
Representative Sequence | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.54 % |
% of genes near scaffold ends (potentially truncated) | 49.57 % |
% of genes from short scaffolds (< 2000 bps) | 84.62 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.487 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere (9.402 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.701 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.684 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 73.33% β-sheet: 0.00% Coil/Unstructured: 26.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00313 | CSD | 37.61 |
PF13419 | HAD_2 | 15.38 |
PF15919 | HicB_lk_antitox | 4.27 |
PF00687 | Ribosomal_L1 | 4.27 |
PF05685 | Uma2 | 4.27 |
PF02894 | GFO_IDH_MocA_C | 3.42 |
PF01408 | GFO_IDH_MocA | 3.42 |
PF02604 | PhdYeFM_antitox | 1.71 |
PF03681 | Obsolete Pfam Family | 1.71 |
PF04563 | RNA_pol_Rpb2_1 | 0.85 |
PF00497 | SBP_bac_3 | 0.85 |
PF16320 | Ribosomal_L12_N | 0.85 |
PF00873 | ACR_tran | 0.85 |
PF13442 | Cytochrome_CBB3 | 0.85 |
PF00162 | PGK | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 4.27 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 4.27 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 3.42 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.71 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.71 |
COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 0.85 |
COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.49 % |
Unclassified | root | N/A | 20.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004479|Ga0062595_100810714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
3300004631|Ga0058899_11955623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 513 | Open in IMG/M |
3300004635|Ga0062388_100762158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
3300004803|Ga0058862_10145291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 749 | Open in IMG/M |
3300005327|Ga0070658_10006657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9363 | Open in IMG/M |
3300005327|Ga0070658_11618962 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300005330|Ga0070690_100298964 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300005336|Ga0070680_100388653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1188 | Open in IMG/M |
3300005337|Ga0070682_101775278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 537 | Open in IMG/M |
3300005338|Ga0068868_100072685 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
3300005344|Ga0070661_100752147 | Not Available | 797 | Open in IMG/M |
3300005458|Ga0070681_10098162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2875 | Open in IMG/M |
3300005459|Ga0068867_100826652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 828 | Open in IMG/M |
3300005534|Ga0070735_10492365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
3300005535|Ga0070684_100573529 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300005539|Ga0068853_102313985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
3300005548|Ga0070665_100209588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1949 | Open in IMG/M |
3300005563|Ga0068855_100125822 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
3300005563|Ga0068855_101544626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 680 | Open in IMG/M |
3300005564|Ga0070664_100765964 | Not Available | 901 | Open in IMG/M |
3300005564|Ga0070664_101237799 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005577|Ga0068857_101143504 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300005577|Ga0068857_101798427 | Not Available | 600 | Open in IMG/M |
3300005614|Ga0068856_101711171 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005718|Ga0068866_10585371 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005841|Ga0068863_100367379 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300005843|Ga0068860_100719951 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300006047|Ga0075024_100105556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1240 | Open in IMG/M |
3300006052|Ga0075029_100331123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 978 | Open in IMG/M |
3300006052|Ga0075029_100916086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 602 | Open in IMG/M |
3300006172|Ga0075018_10031532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2118 | Open in IMG/M |
3300006237|Ga0097621_100356205 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300006354|Ga0075021_10526896 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300006638|Ga0075522_10052464 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
3300006638|Ga0075522_10096477 | Not Available | 1609 | Open in IMG/M |
3300006640|Ga0075527_10120163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
3300006881|Ga0068865_100760271 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300009011|Ga0105251_10501547 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009093|Ga0105240_12393881 | Not Available | 547 | Open in IMG/M |
3300009098|Ga0105245_10585343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
3300009148|Ga0105243_10094032 | Not Available | 2475 | Open in IMG/M |
3300009174|Ga0105241_10601638 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300009176|Ga0105242_10221213 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
3300009176|Ga0105242_10321285 | Not Available | 1420 | Open in IMG/M |
3300009176|Ga0105242_11634901 | Not Available | 679 | Open in IMG/M |
3300009176|Ga0105242_12458535 | Not Available | 569 | Open in IMG/M |
3300009551|Ga0105238_12166223 | Not Available | 590 | Open in IMG/M |
3300009551|Ga0105238_12915999 | Not Available | 514 | Open in IMG/M |
3300010373|Ga0134128_12661330 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300011120|Ga0150983_11586823 | Not Available | 647 | Open in IMG/M |
3300011120|Ga0150983_12716069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 580 | Open in IMG/M |
3300011120|Ga0150983_16661422 | Not Available | 790 | Open in IMG/M |
3300012212|Ga0150985_103888906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 664 | Open in IMG/M |
3300012362|Ga0137361_10889472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 808 | Open in IMG/M |
3300012924|Ga0137413_11834828 | Not Available | 501 | Open in IMG/M |
3300012931|Ga0153915_11843015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 708 | Open in IMG/M |
3300012989|Ga0164305_11345965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 626 | Open in IMG/M |
3300013104|Ga0157370_10868962 | Not Available | 819 | Open in IMG/M |
3300013296|Ga0157374_11412845 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300013308|Ga0157375_11053233 | Not Available | 951 | Open in IMG/M |
3300013832|Ga0120132_1054067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 782 | Open in IMG/M |
3300014159|Ga0181530_10387909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300014167|Ga0181528_10392111 | Not Available | 756 | Open in IMG/M |
3300014325|Ga0163163_10118101 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300014325|Ga0163163_11897709 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300014657|Ga0181522_10524899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 714 | Open in IMG/M |
3300014838|Ga0182030_10256176 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300014968|Ga0157379_10263443 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300015195|Ga0167658_1023296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1703 | Open in IMG/M |
3300015203|Ga0167650_1015509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
3300016728|Ga0181500_1148356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 567 | Open in IMG/M |
3300017792|Ga0163161_10964950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 726 | Open in IMG/M |
3300018468|Ga0066662_11369476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300019256|Ga0181508_1460484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 578 | Open in IMG/M |
3300020076|Ga0206355_1138419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 602 | Open in IMG/M |
3300022532|Ga0242655_10260394 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300025862|Ga0209483_1141437 | Not Available | 1009 | Open in IMG/M |
3300025862|Ga0209483_1259091 | Not Available | 668 | Open in IMG/M |
3300025899|Ga0207642_10324533 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300025903|Ga0207680_10208028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1336 | Open in IMG/M |
3300025909|Ga0207705_10064044 | Not Available | 2657 | Open in IMG/M |
3300025912|Ga0207707_10146252 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300025912|Ga0207707_10493240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1045 | Open in IMG/M |
3300025913|Ga0207695_10314900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1455 | Open in IMG/M |
3300025917|Ga0207660_10633901 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300025921|Ga0207652_11749309 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300025927|Ga0207687_10563962 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300025927|Ga0207687_10688322 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300025927|Ga0207687_11371198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 608 | Open in IMG/M |
3300025931|Ga0207644_10404422 | Not Available | 1116 | Open in IMG/M |
3300025931|Ga0207644_11267989 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300025934|Ga0207686_10418023 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300025934|Ga0207686_11077595 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025949|Ga0207667_10119485 | All Organisms → cellular organisms → Bacteria | 2716 | Open in IMG/M |
3300026023|Ga0207677_11905383 | Not Available | 552 | Open in IMG/M |
3300026078|Ga0207702_11670573 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300026088|Ga0207641_11905090 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300026089|Ga0207648_10050390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3641 | Open in IMG/M |
3300026116|Ga0207674_10050448 | All Organisms → cellular organisms → Bacteria | 4251 | Open in IMG/M |
3300027894|Ga0209068_10266309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 956 | Open in IMG/M |
3300027898|Ga0209067_10529994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 671 | Open in IMG/M |
3300027915|Ga0209069_10503607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 682 | Open in IMG/M |
3300027986|Ga0209168_10164657 | Not Available | 1120 | Open in IMG/M |
3300028379|Ga0268266_10025380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5041 | Open in IMG/M |
3300028381|Ga0268264_11680315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 645 | Open in IMG/M |
3300028800|Ga0265338_10933317 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300030923|Ga0138296_1416332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 665 | Open in IMG/M |
3300030923|Ga0138296_1516032 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300030923|Ga0138296_1804403 | Not Available | 527 | Open in IMG/M |
3300031234|Ga0302325_10139274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4384 | Open in IMG/M |
3300031234|Ga0302325_10470507 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
3300031740|Ga0307468_100444166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1008 | Open in IMG/M |
3300032174|Ga0307470_10149487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1426 | Open in IMG/M |
3300032515|Ga0348332_14173072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 708 | Open in IMG/M |
3300033412|Ga0310810_10161619 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
3300033412|Ga0310810_10431895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1344 | Open in IMG/M |
3300033475|Ga0310811_10267232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2006 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 9.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.69% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.13% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.42% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.71% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.85% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062595_1008107142 | 3300004479 | Soil | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0058899_119556232 | 3300004631 | Forest Soil | MSKTCGDMARFNRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA* |
Ga0062388_1007621582 | 3300004635 | Bog Forest Soil | MSKTCGDTARFHRLRKQKINRRARNRTLQAEIAARKAEKAANPVALKPAA* |
Ga0058862_101452912 | 3300004803 | Host-Associated | MSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKTASAAASKPAA* |
Ga0070658_100066577 | 3300005327 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA* |
Ga0070658_116189621 | 3300005327 | Corn Rhizosphere | CGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0070690_1002989643 | 3300005330 | Switchgrass Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0070680_1003886533 | 3300005336 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA* |
Ga0070682_1017752781 | 3300005337 | Corn Rhizosphere | MSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA* |
Ga0068868_1000726854 | 3300005338 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0070661_1007521471 | 3300005344 | Corn Rhizosphere | RFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA* |
Ga0070681_100981622 | 3300005458 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV* |
Ga0068867_1008266523 | 3300005459 | Miscanthus Rhizosphere | IVMSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0070735_104923653 | 3300005534 | Surface Soil | MSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKAAKP |
Ga0070684_1005735291 | 3300005535 | Corn Rhizosphere | PVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0068853_1023139851 | 3300005539 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAA |
Ga0070665_1002095881 | 3300005548 | Switchgrass Rhizosphere | CGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0068855_1001258225 | 3300005563 | Corn Rhizosphere | MSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0068855_1015446263 | 3300005563 | Corn Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTA* |
Ga0070664_1007659641 | 3300005564 | Corn Rhizosphere | SKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA* |
Ga0070664_1012377991 | 3300005564 | Corn Rhizosphere | SKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0068857_1011435041 | 3300005577 | Corn Rhizosphere | RKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV* |
Ga0068857_1017984272 | 3300005577 | Corn Rhizosphere | FHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA* |
Ga0068856_1017111712 | 3300005614 | Corn Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKASKPAA* |
Ga0068866_105853711 | 3300005718 | Miscanthus Rhizosphere | FMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0068863_1003673792 | 3300005841 | Switchgrass Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIATRKAEKATKPAA* |
Ga0068860_1007199511 | 3300005843 | Switchgrass Rhizosphere | RAFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA* |
Ga0075024_1001055563 | 3300006047 | Watersheds | MSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA* |
Ga0075029_1003311232 | 3300006052 | Watersheds | MSKTCGDTARFHRIRKQKINRRAKNRLLQAEIAARKAEKAAKPAA* |
Ga0075029_1009160862 | 3300006052 | Watersheds | GDTARFHRIRKQKINRRAKNRILQAEIAVRKAEKAANASALKPAA* |
Ga0075018_100315326 | 3300006172 | Watersheds | SSTKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA* |
Ga0097621_1003562052 | 3300006237 | Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA* |
Ga0075021_105268963 | 3300006354 | Watersheds | TARFHRIRKQTINRRAKNRILQAEIAARKAEKAVKPAA* |
Ga0075522_100524644 | 3300006638 | Arctic Peat Soil | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPPA* |
Ga0075522_100964771 | 3300006638 | Arctic Peat Soil | CGDTARFHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA* |
Ga0075527_101201632 | 3300006640 | Arctic Peat Soil | MSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKAAKPAA* |
Ga0068865_1007602712 | 3300006881 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINKRARIRELQAAIAAKKAAAEPKPAA* |
Ga0105251_105015471 | 3300009011 | Switchgrass Rhizosphere | RAFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0105240_123938811 | 3300009093 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPTA* |
Ga0105245_105853432 | 3300009098 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRALQAEISARKAANGEKAKPAA* |
Ga0105243_100940324 | 3300009148 | Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPTA* |
Ga0105241_106016381 | 3300009174 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPA |
Ga0105242_102212131 | 3300009176 | Miscanthus Rhizosphere | KTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKATKPAA* |
Ga0105242_103212852 | 3300009176 | Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKATKPAA* |
Ga0105242_116349011 | 3300009176 | Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTAKPAA* |
Ga0105242_124585351 | 3300009176 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAANGEKAKPAA* |
Ga0105238_121662231 | 3300009551 | Corn Rhizosphere | RLRKEKVMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA* |
Ga0105238_129159991 | 3300009551 | Corn Rhizosphere | RKEKVMSKSCGDTARFHRIRKQKINRRAKNRILQSEIAARKAEKAAKPAA* |
Ga0134128_126613302 | 3300010373 | Terrestrial Soil | MSKTGGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0150983_115868232 | 3300011120 | Forest Soil | MSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAANPIALKPAA* |
Ga0150983_127160692 | 3300011120 | Forest Soil | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKSAKPAA* |
Ga0150983_166614221 | 3300011120 | Forest Soil | MSKTCGDTARFHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA* |
Ga0150985_1038889062 | 3300012212 | Avena Fatua Rhizosphere | MSKTCGDTARFHRLRKQKINRRARNRELQAEIAARKAAAADKAKPAA* |
Ga0137361_108894721 | 3300012362 | Vadose Zone Soil | KKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAATTEKSKPAA* |
Ga0137413_118348282 | 3300012924 | Vadose Zone Soil | MSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAATAVALKPAA* |
Ga0153915_118430153 | 3300012931 | Freshwater Wetlands | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA* |
Ga0164305_113459651 | 3300012989 | Soil | STKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA* |
Ga0157370_108689622 | 3300013104 | Corn Rhizosphere | VRKQKINRRAMNRTLQAEIAARKAEKTAGAAASKPAA* |
Ga0157374_114128451 | 3300013296 | Miscanthus Rhizosphere | KEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAAHKAEKAAKPAA* |
Ga0157375_110532331 | 3300013308 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTT* |
Ga0120132_10540672 | 3300013832 | Permafrost | MSKTCGDTARFHRIRKQKINRRARNRALQAEIAARKAEKAAKPAA* |
Ga0181530_103879092 | 3300014159 | Bog | MSKTCGDTARFHRLRKQRIANRMKVRALRAAIAAKKAAEPPKPAA* |
Ga0181528_103921112 | 3300014167 | Bog | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAVKAASAVALKPAA* |
Ga0163163_101181017 | 3300014325 | Switchgrass Rhizosphere | AFPVSRKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV* |
Ga0163163_118977091 | 3300014325 | Switchgrass Rhizosphere | RKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA* |
Ga0181522_105248991 | 3300014657 | Bog | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKSA |
Ga0182030_102561763 | 3300014838 | Bog | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAVKAASAVALKPAA* |
Ga0157379_102634433 | 3300014968 | Switchgrass Rhizosphere | MSKTCGDTARFHRICKQKINRRAKNRILQAEIAARKAEKAAKPAA* |
Ga0167658_10232962 | 3300015195 | Glacier Forefield Soil | MSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAATALALKPAA* |
Ga0167650_10155094 | 3300015203 | Glacier Forefield Soil | STKKEKVMSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANTEKAKPAA* |
Ga0181500_11483561 | 3300016728 | Peatland | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARK |
Ga0163161_109649502 | 3300017792 | Switchgrass Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAESAARKAEKAAKPA |
Ga0066662_113694762 | 3300018468 | Grasslands Soil | MSKTCGDTARFHRLRKQKIARRARNRALQAEIAERKAAANAEKSKPAA |
Ga0181508_14604842 | 3300019256 | Peatland | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKA |
Ga0206355_11384193 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKT |
Ga0242655_102603941 | 3300022532 | Soil | RVLMSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0209483_11414373 | 3300025862 | Arctic Peat Soil | MSKSCGDTARFHRLRKQKIRMRMRVRELKAAIAERTATADPAKPKA |
Ga0209483_12590912 | 3300025862 | Arctic Peat Soil | FHRLRKQKINRRAKNRLLQAEIAARKAEKAAKPAA |
Ga0207642_103245331 | 3300025899 | Miscanthus Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA |
Ga0207680_102080282 | 3300025903 | Switchgrass Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0207705_100640443 | 3300025909 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKSAGAAASKPAA |
Ga0207707_101462522 | 3300025912 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV |
Ga0207707_104932402 | 3300025912 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRTLQAEIAARKAEKTASAAASKPAA |
Ga0207695_103149004 | 3300025913 | Corn Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTA |
Ga0207660_106339011 | 3300025917 | Corn Rhizosphere | IPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA |
Ga0207652_117493092 | 3300025921 | Corn Rhizosphere | AFPVLRKEKFMSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAV |
Ga0207687_105639621 | 3300025927 | Miscanthus Rhizosphere | TARFHRLRKQKINKRARIRELQAAIAAKKAAAEPKPAA |
Ga0207687_106883222 | 3300025927 | Miscanthus Rhizosphere | MSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA |
Ga0207687_113711981 | 3300025927 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRALQAEISARKAANGEKAKPAA |
Ga0207644_104044223 | 3300025931 | Switchgrass Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAK |
Ga0207644_112679891 | 3300025931 | Switchgrass Rhizosphere | ARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0207686_104180233 | 3300025934 | Miscanthus Rhizosphere | MSKTCGDTARFHRLRKQKINKRARIRELQAAIAAKKAAAEP |
Ga0207686_110775952 | 3300025934 | Miscanthus Rhizosphere | FMSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA |
Ga0207667_101194854 | 3300025949 | Corn Rhizosphere | MSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0207677_119053831 | 3300026023 | Miscanthus Rhizosphere | TARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPTT |
Ga0207702_116705732 | 3300026078 | Corn Rhizosphere | MSKTCGDTARFHRLRKQKINRRAKNRALQAEIAARKAEKASKPAA |
Ga0207641_119050902 | 3300026088 | Switchgrass Rhizosphere | ARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA |
Ga0207648_100503901 | 3300026089 | Miscanthus Rhizosphere | TARFHRIRKQKINRRAKNRVLQAEIAARKAEKAAKPAA |
Ga0207674_100504485 | 3300026116 | Corn Rhizosphere | MSKTCGDTARFHRIRKQKINRRAKNRALQAEIAARKAEKAAKPAA |
Ga0209068_102663091 | 3300027894 | Watersheds | MSKTCGDTARFHRLRKQKIARRARNRALQAEIAARKAANAEKSKPAA |
Ga0209067_105299942 | 3300027898 | Watersheds | MSKTCGDTARFHRIRKQKINRRAKNRVLQAEIAARKAEKAGKPAA |
Ga0209069_105036071 | 3300027915 | Watersheds | MSKTCGDTARFHRIRKQRINMRARVRALRAEIALKNANKTVVATDA |
Ga0209168_101646574 | 3300027986 | Surface Soil | PLRKEKVMSKTCGDTARFHRIRKQKINRRARNRTLQAEIAARKAEKTAGAAASKPAA |
Ga0268266_100253808 | 3300028379 | Switchgrass Rhizosphere | ARFHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0268264_116803152 | 3300028381 | Switchgrass Rhizosphere | FHRLRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
Ga0265338_109333171 | 3300028800 | Rhizosphere | KVMSKTCGDTARFHRLRKQKINRRAKNRMLQAEIAARKAEKAAKPAA |
Ga0138296_14163322 | 3300030923 | Soil | MSKTCGDTARFHRLRKQKINRRAKNRILQAEIAVRKAEKSRQARSVEV |
Ga0138296_15160322 | 3300030923 | Soil | ARFHRLRKQKINRRARNRALQAEIAARKAEKTATAVTLKPAA |
Ga0138296_18044032 | 3300030923 | Soil | GDTARFHRLRKQKIARRARNRALQAEIAARKAATTEKSKPAA |
Ga0302325_101392742 | 3300031234 | Palsa | MSKTCGDTARFHRLRKQKINRRARNRALQAEIAARKAEKAANPVALNPAA |
Ga0302325_104705072 | 3300031234 | Palsa | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAVKAASAVALKPAA |
Ga0307468_1004441662 | 3300031740 | Hardwood Forest Soil | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTANASALKPAA |
Ga0307470_101494872 | 3300032174 | Hardwood Forest Soil | MSKTCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKTAKPAA |
Ga0348332_141730721 | 3300032515 | Plant Litter | MSKTCGDTARFHRLRKQKIAKRTKIRELRAAVEARNEAKKAAAPQPA |
Ga0310810_101616191 | 3300033412 | Soil | MSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKA |
Ga0310810_104318954 | 3300033412 | Soil | KVMSKSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAVKPAA |
Ga0310811_102672324 | 3300033475 | Soil | KSCGDTARFHRIRKQKINRRAKNRILQAEIAARKAEKAAKPAA |
⦗Top⦘ |