NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077705

Metagenome / Metatranscriptome Family F077705

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077705
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence WTGKAYWDYYGYHEDPTTGAVQDLFAPRNFRGNLVTLSVRYAF
Number of Associated Samples 100
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.86 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 93.16 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.094 % of family members)
Environment Ontology (ENVO) Unclassified
(32.479 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.701 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.86%    β-sheet: 0.00%    Coil/Unstructured: 90.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13442Cytochrome_CBB3 66.67
PF03264Cytochrom_NNT 11.11
PF08802Obsolete Pfam Family 6.84
PF00033Cytochrome_B 1.71
PF00355Rieske 1.71
PF13631Cytochrom_B_N_2 0.85
PF04264YceI 0.85
PF00326Peptidase_S9 0.85
PF13424TPR_12 0.85
PF04879Molybdop_Fe4S4 0.85
PF07609DUF1572 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3005Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductaseEnergy production and conversion [C] 11.11
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 1.71
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.58 %
UnclassifiedrootN/A3.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001089|JGI12683J13190_1001954All Organisms → cellular organisms → Bacteria2876Open in IMG/M
3300001593|JGI12635J15846_10000811All Organisms → cellular organisms → Bacteria27160Open in IMG/M
3300002562|JGI25382J37095_10261877All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300004103|Ga0058903_1239222All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300004120|Ga0058901_1349115All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300004137|Ga0058883_1543619All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300004555|Ga0068922_1133640All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300004597|Ga0068947_1150649All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300004631|Ga0058899_12210312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300004631|Ga0058899_12266201All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300005293|Ga0065715_10165322All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300005332|Ga0066388_101195097All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1299Open in IMG/M
3300005440|Ga0070705_101484121All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005468|Ga0070707_100773933All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300005532|Ga0070739_10077338All Organisms → cellular organisms → Bacteria → Acidobacteria1975Open in IMG/M
3300005532|Ga0070739_10514279All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300005537|Ga0070730_10374960All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300005545|Ga0070695_101786849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300005610|Ga0070763_10946135All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005952|Ga0080026_10253517All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006028|Ga0070717_10281657All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300006057|Ga0075026_100454491All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300006162|Ga0075030_100227398All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300006172|Ga0075018_10656521All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300006174|Ga0075014_100924729All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006237|Ga0097621_101587951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300006881|Ga0068865_101216612All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300006904|Ga0075424_102793921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300007076|Ga0075435_100885935All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300007255|Ga0099791_10596126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300007258|Ga0099793_10562864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300009089|Ga0099828_11821099Not Available534Open in IMG/M
3300009520|Ga0116214_1347816All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010043|Ga0126380_10507574All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300010046|Ga0126384_11151111Not Available713Open in IMG/M
3300010360|Ga0126372_11203122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300010362|Ga0126377_10072153All Organisms → cellular organisms → Bacteria3075Open in IMG/M
3300010362|Ga0126377_12747221All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010366|Ga0126379_13594154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300010373|Ga0134128_11282021All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300010376|Ga0126381_100051486All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum5043Open in IMG/M
3300010400|Ga0134122_11444607All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300010880|Ga0126350_11532143All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300011078|Ga0138565_1060863All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300011120|Ga0150983_10579022All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300011120|Ga0150983_12551596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300011120|Ga0150983_13472342All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300011120|Ga0150983_13746805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300011120|Ga0150983_14791203All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012189|Ga0137388_10526566All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300012202|Ga0137363_11192055All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012206|Ga0137380_10291736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1463Open in IMG/M
3300012351|Ga0137386_10193721All Organisms → cellular organisms → Bacteria → Acidobacteria1460Open in IMG/M
3300012351|Ga0137386_10363094All Organisms → cellular organisms → Bacteria → Acidobacteria1042Open in IMG/M
3300012469|Ga0150984_109785719All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012901|Ga0157288_10101145Not Available783Open in IMG/M
3300012944|Ga0137410_10970549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300015371|Ga0132258_12138942All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300015371|Ga0132258_13316871All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300016270|Ga0182036_11142108All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300017927|Ga0187824_10103417All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300017927|Ga0187824_10193123All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300017972|Ga0187781_10544556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300019866|Ga0193756_1059908All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300020579|Ga0210407_10462424All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300020581|Ga0210399_11067496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300021401|Ga0210393_10653931All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300021405|Ga0210387_11481178All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300021405|Ga0210387_11655159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300021406|Ga0210386_10607588All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300021407|Ga0210383_10251324All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300021407|Ga0210383_10468624All Organisms → cellular organisms → Bacteria → Acidobacteria1087Open in IMG/M
3300021420|Ga0210394_10012349All Organisms → cellular organisms → Bacteria8312Open in IMG/M
3300021478|Ga0210402_10094693All Organisms → cellular organisms → Bacteria2675Open in IMG/M
3300021478|Ga0210402_10198983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1841Open in IMG/M
3300021479|Ga0210410_11808221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021559|Ga0210409_10331932All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300021559|Ga0210409_11657611All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300021861|Ga0213853_11077204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium889Open in IMG/M
3300022504|Ga0242642_1092669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300022531|Ga0242660_1212976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300022726|Ga0242654_10245429All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300024182|Ga0247669_1030017All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300025912|Ga0207707_10178919All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300025916|Ga0207663_11299198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300025922|Ga0207646_10717408All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300025928|Ga0207700_10081139All Organisms → cellular organisms → Bacteria → Acidobacteria2532Open in IMG/M
3300025928|Ga0207700_10677901All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300025937|Ga0207669_11470669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300027266|Ga0209215_1036757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300027497|Ga0208199_1112014All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027562|Ga0209735_1016236All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300027565|Ga0209219_1178552All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027591|Ga0209733_1165650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300027773|Ga0209810_1223566All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300027846|Ga0209180_10791792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300027855|Ga0209693_10536865All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300027882|Ga0209590_10889397All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027889|Ga0209380_10840999All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027894|Ga0209068_10159709All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300028281|Ga0247689_1054621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300028906|Ga0308309_11503148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300031231|Ga0170824_115308262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1160Open in IMG/M
3300031247|Ga0265340_10177108All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300031469|Ga0170819_15829932All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031474|Ga0170818_101872975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300031720|Ga0307469_10110062All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300031720|Ga0307469_10500289All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300031754|Ga0307475_10379312All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300031754|Ga0307475_10393019All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300031962|Ga0307479_10379787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1397Open in IMG/M
3300032782|Ga0335082_10439574All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300032893|Ga0335069_12242873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300033004|Ga0335084_11793031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300033134|Ga0335073_11218789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300033289|Ga0310914_10356388All Organisms → cellular organisms → Bacteria → Acidobacteria1323Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.09%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil13.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.98%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.71%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001089Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004120Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004137Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004555Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004597Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011078Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12683J13190_100195413300001089Forest SoilRHWTAKAYWDYYGYHEDPTAGAVVDLFVPRNFRGNLVTLSMRYAF*
JGI12635J15846_10000811283300001593Forest SoilHWTAKAYWDYYGYHEDPTAGAVVDLFVPRNFRGNLVTLSMRYAF*
JGI25382J37095_1026187723300002562Grasslands SoilTGKAYWDYYGYHEDPTSGAVQDSFAPRNFRGNLVTLSVRYAF*
Ga0058903_123922223300004103Forest SoilAYWGYYGYHEDLDPTLVQDIFAPRNFHANLVTLSLRYAF*
Ga0058901_134911513300004120Forest SoilFWDYYGYHEDPTLGAGAVAVQDIYAPRNFRGNLYTLSLKYAF*
Ga0058883_154361913300004137Forest SoilAGKALWDYYGYHEDPTFGTGGEAPIDVFAPRNFRGNLVTLSVRYAF*
Ga0068922_113364013300004555Peatlands SoilYGYHEDPTYGITGAEAVQDIYAPRNFRGNLYTLSVKYAF*
Ga0068947_115064923300004597Peatlands SoilFSKEWTGKAFWDYYGYHEDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF*
Ga0058899_1221031213300004631Forest SoilKAFWDYYGYHEDPTFGITGAEAVQDIYAPRNFRGNLYTLSVKYAF*
Ga0058899_1226620113300004631Forest SoilGKAFWDYYGYHEDPTFGAGTEAAEDIYAPRNFRGNLYTLSLKYAF*
Ga0065715_1016532243300005293Miscanthus RhizosphereRWIGKAYWAYHGYHEDPDVGVVQDIFVPRNFHANLVTISVRYMF*
Ga0066388_10119509733300005332Tropical Forest SoilAKNWTGRALWDYYGYHEDASAVPQDLAAPRNFRGNLFTLSLRYAF*
Ga0070705_10148412123300005440Corn, Switchgrass And Miscanthus RhizosphereFAHHWMARAAWDYYGYHEDPTAGAVEDIFVPRNFRGNLVTLSMRFAF*
Ga0070707_10077393333300005468Corn, Switchgrass And Miscanthus RhizosphereWAGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF*
Ga0070739_1007733843300005532Surface SoilKFSKEWTGKAYWDYYGYHEDSSVGEVQDILAPRNFRGNLVTLSVRYAF*
Ga0070739_1051427923300005532Surface SoilAKAYWGFYGYHEDLTALAQDFFVPRNFHANTVTLSVLYAF*
Ga0070730_1037496013300005537Surface SoilDWTGKFFWDYYGYHEDPTFGTGAIAAQDIFSPRNFRGNLVTLSVKYAF*
Ga0070695_10178684913300005545Corn, Switchgrass And Miscanthus RhizosphereDYRFSKQWTGKFFWDYYGYHEDPTIGAGTIAAQDLFSPRNFRGNLVTLSVRYAF*
Ga0070763_1094613523300005610SoilWDYYGYHEDPTLGTGGEAAQDIFAARNFRGNLYTLSARYAF*
Ga0080026_1025351723300005952Permafrost SoilAFAKAWTGKAYWGYYGYHEDPSLVPQDLAAPRNFRGNLVTLSMRYAF*
Ga0070717_1028165733300006028Corn, Switchgrass And Miscanthus RhizosphereGWTGKAFWDYYGYHEDPTFGTGGTAVQDVFGPRNFRGNLVTLSARYSF*
Ga0075026_10045449133300006057WatershedsYYGYHEDASPVPQDLFAPRNFRGNLVTLSMRYAF*
Ga0075030_10022739813300006162WatershedsKFSKEWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLFTLSVKYAF*
Ga0075018_1065652113300006172WatershedsYYGYHEDPDNVIQDIFAPRNFRANLVTISLRYAF*
Ga0075014_10092472923300006174WatershedsGYYGYHEDESNVVQDIYAPRNFRANLVTLSLRYAF*
Ga0097621_10158795123300006237Miscanthus RhizosphereKAYWGYHNYHEDETPQSPQDIFVPRNFHANLVTLSLRYAF*
Ga0068865_10121661233300006881Miscanthus RhizosphereGYHGYHEDETAQSPQDIFVPRNFHANLVTLSLRYAF*
Ga0075424_10279392113300006904Populus RhizosphereAYWGYHGYHEDETAQSPQDIFVPRNFHANLVTLSLKYAF*
Ga0075435_10088593523300007076Populus RhizosphereKGWTGKAYWGYHDYHEDETTQSPQDIFVPRNFHANLVTLSLRYAF*
Ga0099791_1059612613300007255Vadose Zone SoilKGLTGKAYWGYHGYHEDETPQSPQDIFVPRNFHANLVTLSLRYAF*
Ga0099793_1056286413300007258Vadose Zone SoilKAFWSYYSYHEDPTAAFQDVFASRNFHGNLVTLSVRYAF*
Ga0099828_1182109923300009089Vadose Zone SoilYWGYYGYHEDLTALTQDVFAPRNFRGNTVTLSLRYAF*
Ga0116214_134781613300009520Peatlands SoilEDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF*
Ga0126380_1050757423300010043Tropical Forest SoilGYYGYHEDLTALAQDIFAPRNFHSNTTTLSLQYAF*
Ga0126384_1115111123300010046Tropical Forest SoilWGYYGYHEDLTALSQDVFAPRNFHANTATLSLRYSF*
Ga0126372_1120312213300010360Tropical Forest SoilTGKAFWDYYGYHEDASAVPQDLAALRNFRGNLVTLSLRYAF*
Ga0126377_1007215373300010362Tropical Forest SoilAYWGYYGYHEDSSGVSQDIFAPRNFQSNLVTLSVRYAF*
Ga0126377_1274722133300010362Tropical Forest SoilYWGYHGYHEDPDPGVVQDIFNPRNFHANLVTLSLRYAF*
Ga0126379_1359415423300010366Tropical Forest SoilARNWTGRAYWGFYDYSEDPTASPQDVFAPRNFRGNLETLSVRYAF*
Ga0134128_1128202113300010373Terrestrial SoilRGWTGKAYWGYYGYHEDPSLVPQDLAAPRNFRGNLVTLSMRYAF*
Ga0126381_10005148613300010376Tropical Forest SoilTGKAYWDYYSYHEDPTVSATTGATIAQDQFAPRNFRGNLVTLSVRYAF*
Ga0134122_1144460713300010400Terrestrial SoilERWTGKAYWGYYGYHEDPSAVAQDLFAPRNFRGNLITLSMRYAF*
Ga0126350_1153214313300010880Boreal Forest SoilGKAFWDYYGYHEDPTFGTVGGEAVQDIYAPRNFRGNLYTLSVRYAF*
Ga0138565_106086313300011078Peatlands SoilGYHEDPTYGITGAEAVQDIYAPRNFRGNLYTLSVKYAF*
Ga0150983_1057902213300011120Forest SoilYKFSKNWTGKAFWDYYGYHEDPTFGAGGEAVQDIYAPRNFRGNLYTLSARYAF*
Ga0150983_1255159633300011120Forest SoilGRFYWDYYGYHEDPTAGAVQDVYAPRNFRANLVTLSIRYAF*
Ga0150983_1347234213300011120Forest SoilYHEDPTFGTGGEAVQDLFAPRNFRGNLVTLSLRYAF*
Ga0150983_1374680513300011120Forest SoilEDPTFGITGAEAVQDIYAPRNFRGNLYTLSVKYAF*
Ga0150983_1479120313300011120Forest SoilWTGKAFWDYYGYHEDPTFGAGTEAAEDIYAPRNFRGNLYTLSLKYAF*
Ga0137388_1052656633300012189Vadose Zone SoilFDYRFAKGWTGKAFWDYYGYHEDPTTWAVQDTLAPRNFRGSLVTLSVRYAF*
Ga0137363_1119205533300012202Vadose Zone SoilWGYCGYHEDLTALSQDVFAPRGFHANTTTLSLRYAF*
Ga0137380_1029173613300012206Vadose Zone SoilWTGKAYWDYYGYHEDPTSGAVQDIFAARNFRGNLVTLSVRYAF*
Ga0137386_1019372113300012351Vadose Zone SoilWTGKAYWDYYGYHEDPTTGAVQDLFAPRNFRGNLVTLSVRYAF*
Ga0137386_1036309433300012351Vadose Zone SoilYHEDPAVSTATGAIISQDVLAPRNFRGNLVTLSVKYAF*
Ga0150984_10978571923300012469Avena Fatua RhizosphereGRAYWGYYGYHEDPDNVFQDIFAPRNFRANLVTLSLRYAF*
Ga0157288_1010114533300012901SoilRWVAKAYWAYHGYHEDPDAGVVQDIFAPRNFHANLVTISLRYMF*
Ga0137410_1097054923300012944Vadose Zone SoilTGKAFWSYYNYHEDPTAAFQDIFAPRNFHGNLVTLSVRYAF*
Ga0132258_1213894213300015371Arabidopsis RhizosphereRGYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF*
Ga0132258_1331687133300015371Arabidopsis RhizosphereKAYWGYYGYHEDSSGVPQDIFVPRNFQSNLVTLSVRYAF*
Ga0182036_1114210823300016270SoilWTGKAYYEYYGYHEDPTVSTATGAIIPQDLLAPRNFRGNLVTLSVRYAF
Ga0187824_1010341733300017927Freshwater SedimentWDYYGYHEDPTFGAGTIAVQDIYSPRNFRGNLYTLSVRYAF
Ga0187824_1019312313300017927Freshwater SedimentENWTGKAYWDYYGYHEDPTAGAVQDILAPRNFRGNLFTLSVRYSF
Ga0187781_1054455623300017972Tropical PeatlandWNYYGYHEDFTDVPQDIYAPRNFHANLFLLSARYAF
Ga0193756_105990823300019866SoilKAYWGYYGYHEDLTALPQDVFAPRNFRGNMVTLSLRYAF
Ga0193717_102658013300020060SoilYRFAKHWVGKAFWGYYGYHEDPSDVVQDAFAPRNFRANLVTLSLRYAF
Ga0210407_1046242433300020579SoilKAYWGYYGYHEDQDNVVQDVFAPRNFRANLVTLSLRYAF
Ga0210399_1106749613300020581SoilKSWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLVTLSVRYAF
Ga0210393_1065393113300021401SoilKAFWDYYGYHEDPTFGTVGGEAVQDILAPRNFRGNLYTLSVRYAF
Ga0210387_1148117823300021405SoilGRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSLRYAF
Ga0210387_1165515913300021405SoilLWNYYSYHEDSTAAYQNVFAPRNFHANNVTLSVRYAF
Ga0210386_1060758833300021406SoilKGLTGRVYWGYYGYHEDESNDVQDVFAPRNFRANLVTLSLRYAF
Ga0210383_1025132413300021407SoilTGRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSLRYAF
Ga0210383_1046862423300021407SoilMKGLTGRVYWGYYGYHEDESNVVQDVFAPRNFRANLVTLSL
Ga0210394_10012349103300021420SoilYGYHEDPTLGAGTAAVQDIFAPRNFRGNLYTLSIKYAF
Ga0210402_1009469313300021478SoilAYWGYYGYHEDASDVVQDTFAPRNFRANLVTLSLRYAF
Ga0210402_1019898333300021478SoilWSYYSYHEDSTAAFQDVFAPRNFHGNLVTLSVRYAF
Ga0210410_1180822113300021479SoilDYQFAKSWTGKAYWDYYGYHEDPTAGAVQDIFAARNFRGNLVTLSVRYAF
Ga0210409_1033193213300021559SoilYWGYYGYHEDPSLVPQDLVAPRNFRGNLVTLSMRYAF
Ga0210409_1165761113300021559SoilVAKSWTGKAYWGYYGYHEDLTALTQDAFAPRNFRGNTVTLSLRYVF
Ga0213853_1107720433300021861WatershedsSKQWTGKAFWDYYGYHEDATFGTGNAEAVQDIYAPRNFRGNLYTLSVKYAF
Ga0242642_109266923300022504SoilGKSFWSYYSYHEDSTAAFQDVFAPRNFHGNLVTLSVRYAF
Ga0242660_121297613300022531SoilGGFEYHFAKQWTGKAYWDYYGYHEDPTAGAEQDIFAPRNFRGNLVTLSVRYAF
Ga0242654_1024542913300022726SoilAGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF
Ga0247669_103001733300024182SoilWTGKAYWDYYGYHEDPTAGAVQDVFVPRNFRGNLVTLSLRYSF
Ga0207707_1017891963300025912Corn RhizosphereYGGFDYRFSKQWTGKFFWDYYGYHEDPTIGAGTIAAQDLFSPRNFRGNLVTLSVRYAF
Ga0207663_1129919823300025916Corn, Switchgrass And Miscanthus RhizosphereGGLDYQFAKSWTGKAYWDYYGYHEDPTAGAVQDILAARNFRGNLVTLSVRYAF
Ga0207646_1071740813300025922Corn, Switchgrass And Miscanthus RhizosphereWAGKALWDYYGYHEDPTFGAGGEAVIDVFAPRNFRGNLVTLSLRYAF
Ga0207700_1008113913300025928Corn, Switchgrass And Miscanthus RhizosphereLGRNWTGRAYWGYYGYHEDLTALSQDVFAPRGFHANTTTLSLRYAF
Ga0207700_1067790133300025928Corn, Switchgrass And Miscanthus RhizosphereGLEYKFSKEFTGKAYWDYFGYHEDPSTGAVIDIFAPRNFRANLITLSLRYAF
Ga0207669_1147066923300025937Miscanthus RhizosphereYWGYYGYHEDPSAVAQDLFAPRNFRGNLITLSMRYAF
Ga0209215_103675723300027266Forest SoilRWDYYGYREDLNNSPQDVFAPRNFRGNVVTLSVGYAF
Ga0208199_111201423300027497Peatlands SoilEDATFGTGGAEAAQDIYAPRNFRGNLYTLSLKYAF
Ga0209735_101623613300027562Forest SoilRKEWTGKAFWDYYGYHEDPTFGTTDGEAVQDIYAPRNFRGNLYTLSIRYAF
Ga0209219_117855213300027565Forest SoilYHEDATFGTAGEAVQDIYAPRNFRGNLYTLSVRYAF
Ga0209733_116565023300027591Forest SoilDYYGYHEDPTTGAVQDIFAPRNFRGNLVTLSVRYAF
Ga0209810_122356633300027773Surface SoilEWTGKAYWDYYGYHEDSSVGEVQDILAPRNFRGNLVTLSVRYAF
Ga0209180_1079179223300027846Vadose Zone SoilYYGYHEDPTTGAVQDIFVARNFRGNLFTLSVRYAF
Ga0209693_1053686513300027855SoilGFEYRFSKGWTGKAFWDYYGYHEDPTLGTGGEAAQDIFAARNFRGNLYTLSARYAF
Ga0209590_1088939713300027882Vadose Zone SoilDYYGYHEDPTRGAVQDSFAPRNFRGNLVTLSVRYAF
Ga0209380_1084099913300027889SoilGKAYWDYYGYHEDPTFGTGGEAVQDIFAPRNFRGNLVTLSLRYAF
Ga0209068_1015970913300027894WatershedsGYYGYHEDPDNVIQDIFAPRNFRANLVTISLRYAF
Ga0247689_105462113300028281SoilAGLDYRFAKNWTGRGYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF
Ga0308309_1150314823300028906SoilKALWDYYGYHEDPTFGTGGEAPIDVFAPRNFRGNLVTLSVRYAF
Ga0170824_11530826233300031231Forest SoilWSYYTYHEDPTAANQDVFASRNFHGNLVTLSLRYAF
Ga0265340_1017710813300031247RhizosphereYRFAKSWTGKAFWDYYGYHEDPTFGTTGAEAVQDIFAPRNFRGNLYTLSVRYAF
Ga0170819_1582993223300031469Forest SoilGRAYWGYYGYHEDSDNVVQDIFAPRNFRANLVTLSLRYAF
Ga0170818_10187297513300031474Forest SoilRFAKNWVGRAYWGFYNYHEDQDSVFQDIFAPRNFRGNLVTLSIRYAF
Ga0307469_1011006213300031720Hardwood Forest SoilGLTGKAYWGYYGYHEDPSLVPQDLVAPRNFRGNLVTLSMRYAF
Ga0307469_1050028933300031720Hardwood Forest SoilYRDYYGYHEDPTAGAVQDLFAPRNFRGNLVTLSVRYAF
Ga0307475_1037931213300031754Hardwood Forest SoilWTGRAYWGYYGYHEDASSVVQDFLAPRNFRANLVTLSLRYAF
Ga0307475_1039301933300031754Hardwood Forest SoilHFAKDWTAKAYWDYYGYHEDPTPGTGQDVFAPRNFRANLVTLSVRYAF
Ga0307479_1037978743300031962Hardwood Forest SoilKNWTGKAYWDYYGYHEDPTVSATTGAIIPQDLLAPRNFRGNLVTLSVKYAF
Ga0335082_1043957413300032782SoilWTGKADWDYYGYHEDPTPGAVQDQFAPRNFQGNLVTLSVRYAF
Ga0335069_1224287323300032893SoilHWTGRAFWEYYGYHEDATAAYQDVYASRNFRGNLVTLSVRYAF
Ga0335084_1179303123300033004SoilYRIARQWTGKADWDYYGYHEDPTPGAVQDQFAPRNFQGNLITLSVRYAF
Ga0335073_1121878913300033134SoilAFWDYYSYHEDPTAAYQDVYASRNFHGNLFTLSVRYAF
Ga0310914_1035638843300033289SoilYYGYHEDPTVSAATGAIISQDLLAPRNFRGNLVTLSVKYAF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.