Basic Information | |
---|---|
Family ID | F077689 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 42 residues |
Representative Sequence | VTISQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.71 % |
% of genes near scaffold ends (potentially truncated) | 96.58 % |
% of genes from short scaffolds (< 2000 bps) | 89.74 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.761 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.786 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.573 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.06% β-sheet: 0.00% Coil/Unstructured: 52.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF13419 | HAD_2 | 8.55 |
PF00005 | ABC_tran | 6.84 |
PF12730 | ABC2_membrane_4 | 3.42 |
PF04909 | Amidohydro_2 | 3.42 |
PF08450 | SGL | 2.56 |
PF12679 | ABC2_membrane_2 | 2.56 |
PF12802 | MarR_2 | 1.71 |
PF08241 | Methyltransf_11 | 1.71 |
PF07883 | Cupin_2 | 1.71 |
PF13622 | 4HBT_3 | 1.71 |
PF00106 | adh_short | 0.85 |
PF13530 | SCP2_2 | 0.85 |
PF13091 | PLDc_2 | 0.85 |
PF00196 | GerE | 0.85 |
PF00501 | AMP-binding | 0.85 |
PF03551 | PadR | 0.85 |
PF00583 | Acetyltransf_1 | 0.85 |
PF12680 | SnoaL_2 | 0.85 |
PF04341 | DUF485 | 0.85 |
PF06628 | Catalase-rel | 0.85 |
PF12833 | HTH_18 | 0.85 |
PF13280 | WYL | 0.85 |
PF05762 | VWA_CoxE | 0.85 |
PF00266 | Aminotran_5 | 0.85 |
PF01740 | STAS | 0.85 |
PF01909 | NTP_transf_2 | 0.85 |
PF03435 | Sacchrp_dh_NADP | 0.85 |
PF00067 | p450 | 0.85 |
PF02016 | Peptidase_S66 | 0.85 |
PF13738 | Pyr_redox_3 | 0.85 |
PF01450 | IlvC | 0.85 |
PF07721 | TPR_4 | 0.85 |
PF07690 | MFS_1 | 0.85 |
PF12867 | DinB_2 | 0.85 |
PF03466 | LysR_substrate | 0.85 |
PF01906 | YbjQ_1 | 0.85 |
PF03029 | ATP_bind_1 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.56 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.56 |
COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.71 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.85 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.85 |
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.85 |
COG1619 | Muramoyltetrapeptide carboxypeptidase LdcA (peptidoglycan recycling) | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.85 |
COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
COG3162 | Uncharacterized membrane protein, DUF485 family | Function unknown [S] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.76 % |
Unclassified | root | N/A | 16.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005332|Ga0066388_103781333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300005338|Ga0068868_100090471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2464 | Open in IMG/M |
3300005435|Ga0070714_100585495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1070 | Open in IMG/M |
3300005439|Ga0070711_101441805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 600 | Open in IMG/M |
3300005533|Ga0070734_10121793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1524 | Open in IMG/M |
3300005541|Ga0070733_10367526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 955 | Open in IMG/M |
3300005614|Ga0068856_102605626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300005618|Ga0068864_100902947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
3300006173|Ga0070716_100256490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
3300006175|Ga0070712_101353021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300006175|Ga0070712_102036941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
3300006176|Ga0070765_100027537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4365 | Open in IMG/M |
3300006237|Ga0097621_100496818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1104 | Open in IMG/M |
3300006578|Ga0074059_11573506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 501 | Open in IMG/M |
3300006804|Ga0079221_10178477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis | 1141 | Open in IMG/M |
3300007076|Ga0075435_100036074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3927 | Open in IMG/M |
3300009101|Ga0105247_10115905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
3300009522|Ga0116218_1441218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 580 | Open in IMG/M |
3300009525|Ga0116220_10056386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1641 | Open in IMG/M |
3300009824|Ga0116219_10718548 | Not Available | 546 | Open in IMG/M |
3300010043|Ga0126380_10932013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
3300010360|Ga0126372_11294870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 757 | Open in IMG/M |
3300010371|Ga0134125_10594774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1223 | Open in IMG/M |
3300010373|Ga0134128_11678379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 699 | Open in IMG/M |
3300010376|Ga0126381_100725664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Tu6071 | 1423 | Open in IMG/M |
3300010379|Ga0136449_101509252 | Not Available | 1028 | Open in IMG/M |
3300010379|Ga0136449_104241243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300010396|Ga0134126_10182339 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 2524 | Open in IMG/M |
3300010876|Ga0126361_10098452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 850 | Open in IMG/M |
3300012957|Ga0164303_10145986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1245 | Open in IMG/M |
3300012960|Ga0164301_11340821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
3300012971|Ga0126369_11898809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300013105|Ga0157369_10936333 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300014325|Ga0163163_11059438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 874 | Open in IMG/M |
3300014501|Ga0182024_10492075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
3300014657|Ga0181522_10429220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 792 | Open in IMG/M |
3300014657|Ga0181522_11008885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300016319|Ga0182033_10037975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3148 | Open in IMG/M |
3300016341|Ga0182035_11461487 | Not Available | 615 | Open in IMG/M |
3300017924|Ga0187820_1240710 | Not Available | 578 | Open in IMG/M |
3300017942|Ga0187808_10373802 | Not Available | 649 | Open in IMG/M |
3300017955|Ga0187817_10925404 | Not Available | 558 | Open in IMG/M |
3300017995|Ga0187816_10376580 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300020580|Ga0210403_10838275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 729 | Open in IMG/M |
3300020581|Ga0210399_11404157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans houttuyneae | 545 | Open in IMG/M |
3300020582|Ga0210395_10923941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 648 | Open in IMG/M |
3300020583|Ga0210401_10282058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1521 | Open in IMG/M |
3300020583|Ga0210401_10892265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 748 | Open in IMG/M |
3300021170|Ga0210400_10683743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300021171|Ga0210405_11151595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. HH130629-09 | 577 | Open in IMG/M |
3300021181|Ga0210388_10029912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4464 | Open in IMG/M |
3300021181|Ga0210388_11293869 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300021401|Ga0210393_10704532 | Not Available | 823 | Open in IMG/M |
3300021402|Ga0210385_10125261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1817 | Open in IMG/M |
3300021404|Ga0210389_10663926 | Not Available | 818 | Open in IMG/M |
3300021405|Ga0210387_10234216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
3300021406|Ga0210386_11397652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
3300021407|Ga0210383_10895108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 756 | Open in IMG/M |
3300021433|Ga0210391_11535521 | Not Available | 510 | Open in IMG/M |
3300021474|Ga0210390_10164588 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
3300021478|Ga0210402_10310979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
3300021478|Ga0210402_11825979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300022529|Ga0242668_1100819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 586 | Open in IMG/M |
3300024325|Ga0247678_1010528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1343 | Open in IMG/M |
3300024331|Ga0247668_1061614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 759 | Open in IMG/M |
3300024331|Ga0247668_1112008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
3300025898|Ga0207692_10185583 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300025906|Ga0207699_10008117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5165 | Open in IMG/M |
3300025906|Ga0207699_11483982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
3300025912|Ga0207707_10154523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2006 | Open in IMG/M |
3300025914|Ga0207671_10856571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 719 | Open in IMG/M |
3300025915|Ga0207693_11221023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 566 | Open in IMG/M |
3300025929|Ga0207664_10045003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3459 | Open in IMG/M |
3300025932|Ga0207690_10778330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300025944|Ga0207661_11444415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 631 | Open in IMG/M |
3300027684|Ga0209626_1101735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
3300027795|Ga0209139_10158121 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300027853|Ga0209274_10216146 | Not Available | 977 | Open in IMG/M |
3300027855|Ga0209693_10152028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
3300027895|Ga0209624_10395745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
3300027908|Ga0209006_10357868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
3300028789|Ga0302232_10050552 | Not Available | 2208 | Open in IMG/M |
3300028906|Ga0308309_10411352 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300029943|Ga0311340_11105079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 644 | Open in IMG/M |
3300029943|Ga0311340_11212299 | Not Available | 607 | Open in IMG/M |
3300030007|Ga0311338_11897243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 533 | Open in IMG/M |
3300030503|Ga0311370_10458464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1579 | Open in IMG/M |
3300030520|Ga0311372_12433915 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300030580|Ga0311355_11619150 | Not Available | 555 | Open in IMG/M |
3300031234|Ga0302325_11841112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 756 | Open in IMG/M |
3300031525|Ga0302326_10380981 | Not Available | 2199 | Open in IMG/M |
3300031564|Ga0318573_10609908 | Not Available | 587 | Open in IMG/M |
3300031681|Ga0318572_10787148 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300031718|Ga0307474_10571216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300031723|Ga0318493_10158861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 1174 | Open in IMG/M |
3300031744|Ga0306918_10121155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1896 | Open in IMG/M |
3300031782|Ga0318552_10335122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300031782|Ga0318552_10729427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 506 | Open in IMG/M |
3300031796|Ga0318576_10334341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
3300031798|Ga0318523_10558735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 565 | Open in IMG/M |
3300031819|Ga0318568_10269434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2541 | 1055 | Open in IMG/M |
3300031823|Ga0307478_10541131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 972 | Open in IMG/M |
3300031833|Ga0310917_10990808 | Not Available | 564 | Open in IMG/M |
3300031896|Ga0318551_10116084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1438 | Open in IMG/M |
3300031942|Ga0310916_11664401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 517 | Open in IMG/M |
3300031946|Ga0310910_10396855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300031946|Ga0310910_10776073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300031947|Ga0310909_10744865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300032066|Ga0318514_10361353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300032076|Ga0306924_12105554 | Not Available | 578 | Open in IMG/M |
3300032094|Ga0318540_10034655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2204 | Open in IMG/M |
3300032770|Ga0335085_10456403 | Not Available | 1469 | Open in IMG/M |
3300032783|Ga0335079_11780877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 600 | Open in IMG/M |
3300032896|Ga0335075_11374129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 598 | Open in IMG/M |
3300032898|Ga0335072_11091617 | Not Available | 721 | Open in IMG/M |
3300033134|Ga0335073_10655437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1159 | Open in IMG/M |
3300034199|Ga0370514_114429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.84% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.56% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066388_1037813332 | 3300005332 | Tropical Forest Soil | RVLSVTIGQHNTHLWSAWPQFAVTVIYAAVLLAAGGYLFRKRDA* |
Ga0068868_1000904711 | 3300005338 | Miscanthus Rhizosphere | FFPDAAGRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0070714_1005854952 | 3300005435 | Agricultural Soil | LSVTVGPSNPHLWSAWPQFLVTAIWAVVLVGVGGYLFRKRDA* |
Ga0070711_1014418052 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VISVTVGGGNDHLWSAWPQFLVTVIWAVVLVGVGGYLFRKRDA* |
Ga0070734_101217932 | 3300005533 | Surface Soil | SVTIGDNANPHLWSAWPQLGVTALWAAALLAAGAYLFPKRDA* |
Ga0070733_103675262 | 3300005541 | Surface Soil | NANQHLWSAWPQLGVTALWALALVAAGAWLFRKRDA* |
Ga0068856_1026056261 | 3300005614 | Corn Rhizosphere | FFPDAAGRVLSVTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGAYLFRKRDA* |
Ga0068864_1009029472 | 3300005618 | Switchgrass Rhizosphere | HNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0070716_1002564901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SATVGQSNEHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA* |
Ga0070712_1013530211 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AANQVVSVTIGNNTNPHLWSAWPQLGVTALWAAALVGAGAYLFRKRDA* |
Ga0070712_1020369412 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GQHNPHLWSAWPQFGVTLVYAAVLLGIGSYLFRKRDA* |
Ga0070765_1000275371 | 3300006176 | Soil | VSVTIGNNANAHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA* |
Ga0097621_1004968182 | 3300006237 | Miscanthus Rhizosphere | GRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0074059_115735063 | 3300006578 | Soil | DAAGRVLSVTIGQHNPHLWSAWPQFGVTLVYAAVLLGVGSYLFRKRDA* |
Ga0079221_101784773 | 3300006804 | Agricultural Soil | GPSNPHLWSAWPQFLVTVIWAVVLVGAGGYLFRKRDA* |
Ga0075435_1000360747 | 3300007076 | Populus Rhizosphere | AGRVLSVTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGSYLFRNRDA* |
Ga0105247_101159053 | 3300009101 | Switchgrass Rhizosphere | FPDAAGRVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0116218_14412182 | 3300009522 | Peatlands Soil | DAANQVVSVTIGNNANPHLWSAWPQLGVTAIWAAALLAGGAYLFRKRDA* |
Ga0116220_100563861 | 3300009525 | Peatlands Soil | TIGSNANPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA* |
Ga0116219_107185481 | 3300009824 | Peatlands Soil | NQVVSVTIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA* |
Ga0126380_109320132 | 3300010043 | Tropical Forest Soil | AAGRVLSVTIGQHKKHLSSAWPQSAVTVIYAAVLLAVGGYLFRKRDA* |
Ga0126372_112948702 | 3300010360 | Tropical Forest Soil | GGGNDHLWSAWPQFLVTVLYAVVLVGIGAYLFRKRDA* |
Ga0134125_105947742 | 3300010371 | Terrestrial Soil | FPDAAGRVLSVTIDQHNPHLWSEWPQFGVTLIYAAVLVGVGSYLFRKRDA* |
Ga0134128_116783791 | 3300010373 | Terrestrial Soil | HPHLWSAWPQFAVTVIWALVLVAVGAYLFRKRDA* |
Ga0126381_1007256644 | 3300010376 | Tropical Forest Soil | DAAGRVLSVTIGQQNPHLWSAWPQLGVTLVYAAVLLAVGAYLFRKRDA* |
Ga0136449_1015092521 | 3300010379 | Peatlands Soil | DNADPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA* |
Ga0136449_1042412431 | 3300010379 | Peatlands Soil | QVVSVTISGNANQHLWSAWPQLGVTALWAVALLAVGAYLFRKRDA* |
Ga0134126_101823391 | 3300010396 | Terrestrial Soil | TTGNDTNPHLWSAWPQLGVTALWAAALVAAGAYLFRKRDA* |
Ga0126361_100984521 | 3300010876 | Boreal Forest Soil | NVNPHLWSAWPQLGVTALWTAALVAVGAYLFRKRDA* |
Ga0164303_101459861 | 3300012957 | Soil | RVLSVTIDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0164301_113408212 | 3300012960 | Soil | GRVLSVTIGQHNPHLWSAWPQFGVTLVYAAVLLGVGSYLFRKRDA* |
Ga0126369_118988092 | 3300012971 | Tropical Forest Soil | FPHLWSAWPQFAVTAIYAVVLLAVGGYLFRKRDA* |
Ga0157369_109363331 | 3300013105 | Corn Rhizosphere | AAGRVISVTIGQDNPHLWSAWPQFLVTVIWAVVFVAVGGYLFRKRDA* |
Ga0163163_110594381 | 3300014325 | Switchgrass Rhizosphere | NPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA* |
Ga0182024_104920751 | 3300014501 | Permafrost | NPHLWSAWPQLGVTALWAVALVGVGAYLFRKRDA* |
Ga0181522_104292202 | 3300014657 | Bog | VLSVTLPGQQNPHLWSTWPQFLVTVIWMVVLVGVGGYLFRKRDA* |
Ga0181522_110088851 | 3300014657 | Bog | DAAGRVFSVTVGPANQHLWSAWPQFLVTVVWALVLVGVGGYLFRKRDA* |
Ga0182033_100379755 | 3300016319 | Soil | TEPHLWSAWPQFGVTLIYAAVLLAAGAYLFRKRDA |
Ga0182035_114614872 | 3300016341 | Soil | GQSTDHVWSAWPQFGVTLIYAAVLLAVGAYLFRKRDA |
Ga0187820_12407101 | 3300017924 | Freshwater Sediment | VGQHNPHLWSAWPQFGVTLVYAAVLLGVGAYLFRKRDA |
Ga0187808_103738021 | 3300017942 | Freshwater Sediment | TNPHLWSAWPQFGVTLVYAAVFLAAGAYLFRKRDA |
Ga0187817_109254042 | 3300017955 | Freshwater Sediment | NRVVSVTIGGNANPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0187816_103765802 | 3300017995 | Freshwater Sediment | GSADPHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA |
Ga0210403_108382751 | 3300020580 | Soil | TNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA |
Ga0210399_114041572 | 3300020581 | Soil | TIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0210395_109239411 | 3300020582 | Soil | VISVTVGPQNPHLWSAWPQFLVTVVWAVVLVGVGGYLFRKRDA |
Ga0210401_102820582 | 3300020583 | Soil | VGSDNPHLWSAWPQFLVTVIWAVVLVGVGGYLFRERDA |
Ga0210401_108922652 | 3300020583 | Soil | IGQTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA |
Ga0210400_106837433 | 3300021170 | Soil | ANQHLWSAWPQLGVTALWAAALIGAGAYLFRKRDA |
Ga0210405_111515952 | 3300021171 | Soil | IGNNANQHLWSAWPQLGVTALWAVALIGAGAYLFRKRDA |
Ga0210388_100299121 | 3300021181 | Soil | IAGNAPGHLWSAWPQLGVTALWAAALVAVGAFLFRKRDA |
Ga0210388_112938692 | 3300021181 | Soil | VSVTIGNNAPAHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0210393_107045321 | 3300021401 | Soil | SVTIGSNANSHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0210385_101252613 | 3300021402 | Soil | RSVITITVGGGNPHLWSAWPQLGVTALWAVALVGIGGYLFRKRDA |
Ga0210389_106639261 | 3300021404 | Soil | TIGSNANSHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0210387_102342163 | 3300021405 | Soil | GSADPHLWSAWPQLGVTALWAAALLGAGAYLFRKRDA |
Ga0210386_113976521 | 3300021406 | Soil | SVTIPGSADPHLWSAWPQLGVTALWAAALLAGGAYLFRKRDA |
Ga0210383_108951081 | 3300021407 | Soil | DAAGRVLSVTIGQTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA |
Ga0210391_115355211 | 3300021433 | Soil | SVTIGQTNQHLWSAWPQFGVTLIYAAVFLAIGAYLFRKRDA |
Ga0210390_101645884 | 3300021474 | Soil | VVSVTIGENANQHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0210402_103109791 | 3300021478 | Soil | GRVLSVTIGQTNQHLWSAWPQFGVTLIYAAVFLAVGAYLFRKRDA |
Ga0210402_118259791 | 3300021478 | Soil | GRVLSVTIGGNSNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0242668_11008192 | 3300022529 | Soil | VPSVTIGQTNQHLWSAWPQFGVTLIYAAVFLAVGAYLFRKRDA |
Ga0247678_10105281 | 3300024325 | Soil | IDQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA |
Ga0247668_10616141 | 3300024331 | Soil | IGQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA |
Ga0247668_11120081 | 3300024331 | Soil | VLSVTIGQHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA |
Ga0207692_101855832 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VTIGQHNPHLWSEWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0207699_100081171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IDQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA |
Ga0207699_114839821 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QHNPHLWSEWPQFGVTLVYAAVLLGVGSYLFRKRDA |
Ga0207707_101545233 | 3300025912 | Corn Rhizosphere | DHPHLWSAWPQFAVTVIWALVLVAVGAYLFRKRDA |
Ga0207671_108565711 | 3300025914 | Corn Rhizosphere | IGQHNPHLWSEWPQFGITLIYAAVLLGVGSYLFRKRDA |
Ga0207693_112210231 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PSAAGQVISMTVPGDQSAHLWSAWPQLLVTVVWAVVLIGAGGFLFRKRDA |
Ga0207664_100450035 | 3300025929 | Agricultural Soil | IGQHNPHLWSEWPQFGITLVYAAVLLGVGSYLFRKRDA |
Ga0207690_107783303 | 3300025932 | Corn Rhizosphere | VISVTVGQDDPHLWSAWPQFLVTVIWAVVLVAVGGYLFRKRDA |
Ga0207661_114444151 | 3300025944 | Corn Rhizosphere | PDAAGRVLSVTVGPSNPHLWSAWPQFLVTAIWAVVLVGAGGYLFRKRDA |
Ga0209626_11017351 | 3300027684 | Forest Soil | ANQVVSLTIAGNAPGHLWSAWPQLGVTALWAAAPVAVGAFLFRKRDA |
Ga0209139_101581211 | 3300027795 | Bog Forest Soil | SASPHLWSAWPQLGVTALWAAVLLGVGAYLFRKRDA |
Ga0209274_102161462 | 3300027853 | Soil | SANPHLWSAWPQLGVTALWAAALLAAGGYLFRKRDA |
Ga0209693_101520281 | 3300027855 | Soil | PDAANRVVSVTIGGNADPHLWSAWPQLGVTALWAAALLAAGAYLFRKRDA |
Ga0209624_103957453 | 3300027895 | Forest Soil | SVTLPGQQNAHLWSAWPQFLVTVVWAVVLVGVGGYLFRKRDA |
Ga0209006_103578683 | 3300027908 | Forest Soil | NQVVSTTIAGNGPGHLWSAWPQLGVTALWAVVLVGIGAYLFRKRDA |
Ga0302232_100505525 | 3300028789 | Palsa | TIGPTSPNLWSAWPQLGVTALWAAALVALGAYLFRHRDA |
Ga0308309_104113523 | 3300028906 | Soil | ANQVVSVTFGPSANPHLWSAWPQLGVTALWAAALLAAGGYLFRKRDA |
Ga0311340_111050792 | 3300029943 | Palsa | VTVGPDNIHLWSAWPQLGVTALWAAALVGIGAYLFRTRDA |
Ga0311340_112122991 | 3300029943 | Palsa | AANQVVSVTVGPGNMHLWSAWPQLGVTALWAAVLLTIGAYLFRKRDA |
Ga0311338_118972432 | 3300030007 | Palsa | NQVVTVTIGGNSNPHLWSAWPQLGVTALWAVALVAIGAYLFRKRDA |
Ga0311370_104584641 | 3300030503 | Palsa | RFFPDGAGRVLSVTVGQHVAHLWSAWPQFGVTLIYAAVLLAVGAYLFRTRDA |
Ga0311372_124339152 | 3300030520 | Palsa | SITVGGGNPHLWSYWPQFAVTAIYAAALLAIGAYLFRQRDA |
Ga0311355_116191501 | 3300030580 | Palsa | ANQVVSVTVGPGNMHLWSAWPQLGVTALWAAVLLTIGAYLFRKRDA |
Ga0302325_118411121 | 3300031234 | Palsa | IASNGPGHLWSAWPQLGVTAVWAAVLIGIGAYLFRKRDA |
Ga0302326_103809814 | 3300031525 | Palsa | VVSVTIGDSNQHLWSAWPQLGVTALWAAILVGVGAYLFRKRDA |
Ga0318573_106099082 | 3300031564 | Soil | TNPHLWSAWPQLGVTALWAVALIAAGSYLFRKRDA |
Ga0318572_107871482 | 3300031681 | Soil | SAGRVISVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA |
Ga0307474_105712161 | 3300031718 | Hardwood Forest Soil | FFPDEAGRVISVTVGSANPHLWSAWPQLLVTVAWAAVLIGVGGYLFRKRDA |
Ga0318493_101588613 | 3300031723 | Soil | PSGGEVYHMWSAWPQFAVTAVYAVVLLAIGAYLFRKRDA |
Ga0306918_101211554 | 3300031744 | Soil | RFMPDSAGRVISVTVAGNEFPHLWSAWPQFAVTVIYAAVLLGVGGYLFRRRDA |
Ga0318552_103351222 | 3300031782 | Soil | HNEHLWSAWPQFGVTLIYAVVLLATGAYLFRKRDA |
Ga0318552_107294271 | 3300031782 | Soil | VRFMPDSAGRVISVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA |
Ga0318576_103343411 | 3300031796 | Soil | GQHNPHLWSAWPQFGVTLVYAAVLLGVGAYLFRRRDA |
Ga0318523_105587352 | 3300031798 | Soil | AAGRVLSVTVGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0318568_102694341 | 3300031819 | Soil | GRVLSVTVGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0307478_105411311 | 3300031823 | Hardwood Forest Soil | QTNQHLWSAWPQFGVTLIYAAVFLTVGAYLFRKRDA |
Ga0310917_109908081 | 3300031833 | Soil | RVLSKTIGQTEPHLWSAWPQFGVTLIYAAVLLAAGAYLFRKRDA |
Ga0318551_101160842 | 3300031896 | Soil | GQHNPHLWSAWPQFGVTLVYAAVLVGIGAYLFRRRDA |
Ga0310916_116644011 | 3300031942 | Soil | GRVLSVTIGQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0310910_103968553 | 3300031946 | Soil | QDNPHLWSAWPQFGVTLIYAAVLLLAGAYLFRKRDA |
Ga0310910_107760731 | 3300031946 | Soil | GRVVSVTVAGNEFPHLWSAWPQFAVTAIYAAVLLGVGGYLFRKRDA |
Ga0310909_107448651 | 3300031947 | Soil | SVTIGQDNPHLWSAWPQFGVTLIYAAVLLLAGAYLFRKRDA |
Ga0318514_103613531 | 3300032066 | Soil | PDAAGRVLSVTIGQHNEHLWSAWPQFGVTLIYAVVLLATGAYLFRKRDA |
Ga0306924_121055542 | 3300032076 | Soil | AGRVLSKTIGQTEPHLWSAWPQFGVTLIYAAVLLAVGAYLFRKRDA |
Ga0318540_100346554 | 3300032094 | Soil | AGTEFPHLWSAWPQFAVTAIYAVVLLAVGGYLFRKRDA |
Ga0335085_104564031 | 3300032770 | Soil | PDAAGRVLSVTIGQHNPHLWSAWPQFGVTLIYAAVLLGAGAYLFRKRDA |
Ga0335079_117808771 | 3300032783 | Soil | TLPGQQNPHLWSTWPQFLVTVIWAAAFIGIGGYLFRKRDA |
Ga0335075_113741291 | 3300032896 | Soil | GRVLSVTTGQTAQHLWSAWPQFGVTLIYAAVLVALGGYLFRRRDA |
Ga0335072_110916172 | 3300032898 | Soil | VTISQHNPHLWSAWPQFGVTLIYAAVLLGVGAYLFRKRDA |
Ga0335073_106554371 | 3300033134 | Soil | VGQHNPHLWSAWPQFGVTLVYAAVLLGAGAYLFRKRDA |
Ga0370514_114429_539_673 | 3300034199 | Untreated Peat Soil | VVSVTIGNNGNPHLWSAWPQLGVTALWAAVLLGAGAYLFRKRDA |
⦗Top⦘ |