NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077645

Metagenome / Metatranscriptome Family F077645

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077645
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 46 residues
Representative Sequence MQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLAL
Number of Associated Samples 105
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.58 %
% of genes near scaffold ends (potentially truncated) 98.29 %
% of genes from short scaffolds (< 2000 bps) 95.73 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.872 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.205 % of family members)
Environment Ontology (ENVO) Unclassified
(39.316 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.444 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.68%    β-sheet: 16.90%    Coil/Unstructured: 70.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00596Aldolase_II 34.19
PF01977UbiD 4.27
PF13356Arm-DNA-bind_3 1.71
PF00027cNMP_binding 0.85
PF03169OPT 0.85
PF04392ABC_sub_bind 0.85
PF00108Thiolase_N 0.85
PF02775TPP_enzyme_C 0.85
PF05598DUF772 0.85
PF03480DctP 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 4.27
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.85
COG1297Predicted oligopeptide transporter, OPT familyGeneral function prediction only [R] 0.85
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.87 %
UnclassifiedrootN/A5.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0998087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria741Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101614080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300004463|Ga0063356_101457746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1011Open in IMG/M
3300005332|Ga0066388_102585160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria924Open in IMG/M
3300005332|Ga0066388_106905635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300005340|Ga0070689_101621912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300005436|Ga0070713_100459568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1197Open in IMG/M
3300005549|Ga0070704_101008612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium753Open in IMG/M
3300005713|Ga0066905_100793509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria821Open in IMG/M
3300005764|Ga0066903_103114266Not Available898Open in IMG/M
3300005764|Ga0066903_104213933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria769Open in IMG/M
3300006038|Ga0075365_10158268All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300006173|Ga0070716_101436772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300006195|Ga0075366_10641656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300006755|Ga0079222_12456324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300006806|Ga0079220_10628650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300006871|Ga0075434_101008330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria846Open in IMG/M
3300006880|Ga0075429_100350464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1292Open in IMG/M
3300007076|Ga0075435_101033286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium718Open in IMG/M
3300009088|Ga0099830_10433563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1066Open in IMG/M
3300009090|Ga0099827_10268472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1438Open in IMG/M
3300009092|Ga0105250_10458953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300010043|Ga0126380_11806316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300010159|Ga0099796_10162230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300010339|Ga0074046_10234562All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300010362|Ga0126377_11741815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300010366|Ga0126379_12094916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300010376|Ga0126381_102297607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria775Open in IMG/M
3300010398|Ga0126383_13256383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300011119|Ga0105246_11507021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300011269|Ga0137392_10209825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1595Open in IMG/M
3300012201|Ga0137365_11113950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300012207|Ga0137381_10817185Not Available808Open in IMG/M
3300012363|Ga0137390_11615881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300012925|Ga0137419_10588288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria893Open in IMG/M
3300012927|Ga0137416_10465349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1083Open in IMG/M
3300012929|Ga0137404_10702409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium915Open in IMG/M
3300012961|Ga0164302_10057544All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300012971|Ga0126369_12664055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300015264|Ga0137403_10737598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria844Open in IMG/M
3300015372|Ga0132256_100957856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria972Open in IMG/M
3300016270|Ga0182036_10952691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300016270|Ga0182036_11584982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300016294|Ga0182041_11786246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300016294|Ga0182041_12265626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300016319|Ga0182033_11217628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria675Open in IMG/M
3300016319|Ga0182033_11346844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria642Open in IMG/M
3300016357|Ga0182032_11597732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300016371|Ga0182034_11625835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300016387|Ga0182040_10385437Not Available1096Open in IMG/M
3300016404|Ga0182037_10329806All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300016445|Ga0182038_11413987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria623Open in IMG/M
3300018081|Ga0184625_10613014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300018433|Ga0066667_10385624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1127Open in IMG/M
3300018468|Ga0066662_12664634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300018482|Ga0066669_10168470All Organisms → cellular organisms → Bacteria → Proteobacteria1636Open in IMG/M
3300020580|Ga0210403_11016347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria648Open in IMG/M
3300020581|Ga0210399_10744969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium803Open in IMG/M
3300021178|Ga0210408_10862315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300021560|Ga0126371_10618630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1232Open in IMG/M
3300021951|Ga0222624_1092165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300025899|Ga0207642_10703786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300025923|Ga0207681_10149106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1750Open in IMG/M
3300025934|Ga0207686_11239983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300026088|Ga0207641_10062868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3169Open in IMG/M
3300026088|Ga0207641_11023152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria823Open in IMG/M
3300026308|Ga0209265_1109975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300026507|Ga0257165_1021018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1101Open in IMG/M
3300027310|Ga0207983_1051262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria540Open in IMG/M
3300027516|Ga0207761_1083229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300027880|Ga0209481_10421432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300028380|Ga0268265_10367316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1319Open in IMG/M
3300028536|Ga0137415_10915318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300028608|Ga0247819_10254338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria967Open in IMG/M
3300028718|Ga0307307_10029046All Organisms → cellular organisms → Bacteria → Proteobacteria1563Open in IMG/M
3300028784|Ga0307282_10108574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1293Open in IMG/M
3300028793|Ga0307299_10075785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1250Open in IMG/M
3300028807|Ga0307305_10107466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1289Open in IMG/M
3300028828|Ga0307312_11017955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300028878|Ga0307278_10299282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300031198|Ga0307500_10197582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300031544|Ga0318534_10292043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria939Open in IMG/M
3300031546|Ga0318538_10026993All Organisms → cellular organisms → Bacteria → Proteobacteria2637Open in IMG/M
3300031549|Ga0318571_10308304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria597Open in IMG/M
3300031564|Ga0318573_10268153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria911Open in IMG/M
3300031564|Ga0318573_10614009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300031573|Ga0310915_10168014Not Available1524Open in IMG/M
3300031573|Ga0310915_10836457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300031723|Ga0318493_10235715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria974Open in IMG/M
3300031736|Ga0318501_10112997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1367Open in IMG/M
3300031763|Ga0318537_10278912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300031763|Ga0318537_10300047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300031765|Ga0318554_10017814All Organisms → cellular organisms → Bacteria → Proteobacteria3665Open in IMG/M
3300031770|Ga0318521_10490928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300031771|Ga0318546_10449087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria902Open in IMG/M
3300031795|Ga0318557_10039675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1945Open in IMG/M
3300031819|Ga0318568_10417496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria836Open in IMG/M
3300031831|Ga0318564_10184649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300031833|Ga0310917_10967189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300031879|Ga0306919_11222075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300031890|Ga0306925_11023286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria840Open in IMG/M
3300031890|Ga0306925_11206622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300031893|Ga0318536_10124392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1303Open in IMG/M
3300031893|Ga0318536_10218502Not Available970Open in IMG/M
3300031894|Ga0318522_10313483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300031897|Ga0318520_10011641All Organisms → cellular organisms → Bacteria → Proteobacteria3869Open in IMG/M
3300031947|Ga0310909_10896528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300031954|Ga0306926_11291663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria852Open in IMG/M
3300031959|Ga0318530_10009634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3054Open in IMG/M
3300032035|Ga0310911_10275623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium965Open in IMG/M
3300032043|Ga0318556_10471223Not Available657Open in IMG/M
3300032052|Ga0318506_10299091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria713Open in IMG/M
3300032066|Ga0318514_10392602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300032261|Ga0306920_103606471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300032261|Ga0306920_103705015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300033290|Ga0318519_10181979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1191Open in IMG/M
3300033550|Ga0247829_10207865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1558Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.71%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300027310Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_099808722228664022SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTDNGTLAQLR
INPhiseqgaiiFebDRAFT_10161408023300000364SoilMQTKRTYQVQHWPNGHWNPQHNWRKVEAGSEKEAAEKVCGLPLTERGTLAQLRARVLIF
Ga0063356_10145774613300004463Arabidopsis Thaliana RhizosphereMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCG
Ga0066388_10258516013300005332Tropical Forest SoilMKHRGQKMQTKRTYQVQHWPNGHWNPEHNWRKVEAGSEKEAAEKVCGLPLTEHGTL
Ga0066388_10690563523300005332Tropical Forest SoilMQTQRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCG
Ga0070689_10162191223300005340Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRALKQDGKLAQ
Ga0070713_10045956833300005436Corn, Switchgrass And Miscanthus RhizosphereMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLR
Ga0070704_10100861223300005549Corn, Switchgrass And Miscanthus RhizosphereMQTKRTYQVQHWPDGQWNPEHNWRKIEAASEKEAAEKVCGLALTEHGTLA
Ga0066905_10079350923300005713Tropical Forest SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLALTERGTLAQLRARV
Ga0066903_10311426613300005764Tropical Forest SoilMQTNRIYQVQHWPNGQWDRWHNWQKVEAGSEKEAAE
Ga0066903_10421393313300005764Tropical Forest SoilMQTRRTYQVQHWPNGQWSPEHNWRKVEAGSEKEAAEKVCGL
Ga0075365_1015826813300006038Populus EndosphereMQTRRTYQVQHWPNGQWDREYNWRKVEAASEKEAAEKVCGLRLTNEGKLAQLRA
Ga0070716_10143677233300006173Corn, Switchgrass And Miscanthus RhizosphereMQTKRTYQVQHWPNGHWNPEHNWRKIEAGSEKEAAERVCGLP
Ga0075366_1064165623300006195Populus EndosphereMQTQRTYQVQHWPDGQWSREHNWKKVVAGSAKEAAEKVCGRPLKQD
Ga0079222_1245632423300006755Agricultural SoilMQTRRTYQVQHWPNGQWNPQHNWRKVEAGSEKEAAEKVCGLRLTERGTLAQL
Ga0079220_1062865013300006806Agricultural SoilMQTKRTYQVQHWPNGEWNPQHNWRKVEAGSEKEAAEKVCGLPLT
Ga0075434_10100833023300006871Populus RhizosphereMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTDNGTLA
Ga0075429_10035046423300006880Populus RhizosphereMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRALKQNGKLAQLRA
Ga0075435_10103328613300007076Populus RhizosphereMQTKRTYQVQHWPNGEWNPQHNWRKVEAGSEKEAAEKVCGLP
Ga0099830_1043356323300009088Vadose Zone SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEK
Ga0099827_1026847213300009090Vadose Zone SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEK
Ga0105250_1045895313300009092Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSREHNWKKVEAASETEAAEKVCGRALKPD
Ga0126380_1180631623300010043Tropical Forest SoilMMQTKKTYQVQHWPNGQWSPMDNWCKIEAATAKEAAEKVCGLALTDQGT
Ga0099796_1016223013300010159Vadose Zone SoilMQTRRTYHVQHWPDGQWNPEHSWKKIEAGSEKEAAEK
Ga0074046_1023456213300010339Bog Forest SoilMQTKRIYQVQHWPNGRWDRWHNWQKVAAGSEKEAAEK
Ga0126377_1174181513300010362Tropical Forest SoilMQTKKTYQVQHWPNGQWSPMDNWCKIEAATAKEAAEK
Ga0126379_1209491613300010366Tropical Forest SoilMQTKKTYQVQHWPNGQWSPMDNWCKIEAATAKQAAEKVCG
Ga0126381_10229760713300010376Tropical Forest SoilMQAKRTYQVQHWPNGQWSREHNWRKVDAASEKEAA
Ga0126383_1325638313300010398Tropical Forest SoilMRTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAE
Ga0105246_1150702123300011119Miscanthus RhizosphereMQTQRTYQVQHWPNGQWSLEHNWKKVEAASEKEAAEK
Ga0137392_1020982513300011269Vadose Zone SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLALRDCGTLAQL
Ga0137365_1111395013300012201Vadose Zone SoilMQTKRTYQVQHWPNGQWDREHNWRKVEAASEKEAAEKVCGRALSSRGTLAQLRARV
Ga0137381_1081718523300012207Vadose Zone SoilMQTKRIYQVQHWPNGQWDREHNWRKVEAASDKEAAEKL*
Ga0137390_1161588123300012363Vadose Zone SoilMQTKRIYQVQHWPDGHWDREHNWRKVEAGSEKEAAEKVCGLALS
Ga0137419_1058828823300012925Vadose Zone SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAE
Ga0137416_1046534913300012927Vadose Zone SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLPLAERGTLAQLRARVLT
Ga0137404_1070240913300012929Vadose Zone SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTDNGTLARLRARVLTF
Ga0164302_1005754433300012961SoilMQTKRTYQVQHWPNGQWNPEHNWRKVDAGSEKEAAEKVCGLPLTERGTLAQLR
Ga0126369_1266405513300012971Tropical Forest SoilMQTRRTYQVQHWHDGQWNPEHNWRKIEANTEKEAAEKMCGLALT
Ga0137403_1073759813300015264Vadose Zone SoilVQHWPNGQWDRGRNWQKVAAGSEKEAAEKVCGLTLRREGRLAQLRAR
Ga0132256_10095785613300015372Arabidopsis RhizosphereMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTDNGTLARLR
Ga0182036_1095269123300016270SoilMQTKRLYQVQHWPNGQWDRGNNWRKVEAGSEKEAAEMVCGLSLTSNGRLAQLRARVLR
Ga0182036_1158498223300016270SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGL
Ga0182041_1178624623300016294SoilMQTKWIYQVQCWPNGQWDRQHNWQKVVAGSEKEAAEKVCGFALT
Ga0182041_1226562623300016294SoilMQTNRIYQVQHWPNGQWDRRHNWQKVEAGSEKEAAEKVCGFALT
Ga0182033_1121762813300016319SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTEN
Ga0182033_1134684413300016319SoilMQTKRIYQVQHWSNGQWDRRHNWQKVEAGSEKEAAEKVCGFALTREGRLAQLRARVLR
Ga0182032_1159773223300016357SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALT
Ga0182034_1162583513300016371SoilMQSKRIDQVQHRPKGEWDRSHNWQKVEARTEQEAAEKVCGLTLTREGRLAQLRARV
Ga0182040_1038543713300016387SoilMQTNRIYQVQHWPNGQWDRQHNWQKIEAESEKEAAEKVCGFALTQTGRLAQLRARV
Ga0182037_1032980613300016404SoilMQTNRIYQVQHWPNGQWDRRHNWQKIEAGSEKEAAEKVCGFAL
Ga0182038_1141398713300016445SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTENGTLAQL
Ga0184625_1061301413300018081Groundwater SedimentMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRALKQDGKLAQLRAR
Ga0066667_1038562413300018433Grasslands SoilMQTKRVYQVQHWPNGEWDRRHNWQKITAGSEKGAGE
Ga0066662_1266463423300018468Grasslands SoilMIYQVQHWPNGRWDRWHNWQKVEAGSEKEAAEKVCGFALTQAGRLAQLRARVLR
Ga0066669_1016847013300018482Grasslands SoilMQTKRTYQVQHWPNGEWSPQHNWRKVDAGSEKEAAEKVCGLPLTERGT
Ga0210403_1101634723300020580SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEAKSEKEAAEKVCGLALTDNGT
Ga0210399_1074496923300020581SoilMQTKRTYQVQHWPNGHWNPEHNWRKVEAGSEKEAAEKVCGL
Ga0210408_1086231523300021178SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEAKSEKEAA
Ga0126371_1061863013300021560Tropical Forest SoilMQTKRTYQVQHWPDGQWNPEHNWRKIEAASEKEAAEKVCGL
Ga0222624_109216523300021951Groundwater SedimentMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRPLKQDGKLAQLRARV
Ga0207642_1070378613300025899Miscanthus RhizosphereMHTQRTYQVQHWPNGQWSLEHNWKKVEAASEKEAAEKVC
Ga0207681_1014910613300025923Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCG
Ga0207686_1123998313300025934Miscanthus RhizosphereMHTQRTYQVQHWPNGQWSLEHNWKKVEAASEKEAAEKV
Ga0207641_1006286843300026088Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRA
Ga0207641_1102315213300026088Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKV
Ga0209265_110997513300026308SoilMQTRRIYQVQHWPDGQWDRDHNWQKVEAASEKEAAEKICGRALNKRGNLAQ
Ga0257165_102101813300026507SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLALRDCGTLAQLRARVLTF
Ga0207983_105126213300027310SoilMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCGRALKQD
Ga0207761_108322913300027516Tropical Forest SoilMQTKRIYQVQSWPNGQWDRQHNWKKVVAGSEKEAAEKVCGFALTQAGR
Ga0209481_1042143213300027880Populus RhizosphereMQTKRTYQVQHWPNGEWNPQHNWRKVEAGSEKEAAEMVCGLPLSEAGKLAQLRAR
Ga0268265_1036731633300028380Switchgrass RhizosphereMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKV
Ga0137415_1091531823300028536Vadose Zone SoilMQTKRTYQVQHWPNGQWNPEHNWRKVEAGSEKEAAEKVCGLAL
Ga0247819_1025433833300028608SoilMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRAR
Ga0307307_1002904633300028718SoilMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRPL
Ga0307282_1010857413300028784SoilMQTQRTYQVQHWPNGQWSREHNWKKVEAASEKEAAEKVCGRPLKQDGKLAQ
Ga0307299_1007578513300028793SoilMQTKRTYQVQHWPNGQWCPQHNWRKVEAGSEKEAAELICGLAL
Ga0307305_1010746623300028807SoilMQTKRTYQVQHWPNGQWCPQHNWRKVEAGSEKEAAELICGRP
Ga0307312_1101795523300028828SoilMQTKRTYQVQHWPNGQWSPQHNWRKVEAGSEKEAAELICGRPLKQD
Ga0307278_1029928223300028878SoilMQTKRTYQVQHWPNGQWNPEHNWRKVDAGSEKEAAEKVCGLPLTERGTLAQ
Ga0307500_1019758213300031198SoilMQTQRTYQVQHLPNGQWSREHNWKKVEAASAKEAAEKVCGRALK
Ga0318534_1029204323300031544SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCG
Ga0318538_1002699333300031546SoilMQTKRTYQVQHWPDGQWNPEHNWHKIEAASEKEAAEKVCGLALTEHGTLA
Ga0318571_1030830423300031549SoilMQTNRIYQVQHWPNGQWDRLHNWQKVEAGSEKEAAEKVCGFALTQTGRL
Ga0318573_1026815313300031564SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALT
Ga0318573_1061400923300031564SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSKKEAAEKVCGLALTEN
Ga0310915_1016801443300031573SoilMQTNRIYQVQHWPNGQWDRLHNWQKVEAGSEKEAAEKVC
Ga0310915_1083645713300031573SoilMQTKRIYQVQHWSNGQWDRRHNWQKVEAGSEKEAAEKVCGFA
Ga0318493_1023571513300031723SoilMQTRRTYQVQHWPDGHWSPEHNWRKIEANSEKEAAEKVCGLAL
Ga0318501_1011299713300031736SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTDNGTLAQLRARVLT
Ga0318537_1027891223300031763SoilMQTNRIYQVQHWPNGQWDRRHNWQKIEAGSEKEAAEKVCGFALKQTGRLAQ
Ga0318537_1030004713300031763SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCG
Ga0318554_1001781413300031765SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSKKEAAEKVCGLALTENGTLAQLRARVLT
Ga0318521_1049092813300031770SoilMQTKRLYQVQHWPNGQWDRGNNWRKVEAGSEKEAAEMVCGLSLTSNGRLAQLRARV
Ga0318546_1044908723300031771SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLA
Ga0318557_1003967533300031795SoilMQTRRIYQVQHWPNGQWDRDHNWRKVEAGSEKEAAEKVCGFALTAT
Ga0318568_1041749623300031819SoilMQTKRLYQVQHWPNGQWDRGNNWRKVEAGSEKEAAEMVCGLSLTSNGRLAQLRA
Ga0318564_1018464923300031831SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTENGTLAQLRARVL
Ga0310917_1096718913300031833SoilMQTRRTYQVQHWPDGHWSPEHNWRKIEANSEKEAAEKVCGLALTANGTLAQLRARVLT
Ga0306919_1122207513300031879SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTEN
Ga0306925_1102328613300031890SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTENGTLAQLRA
Ga0306925_1120662213300031890SoilMQTKRIFQVQSWPNGQWDRQHNWQKVEAGNEKEAAEKVCGFALAQT
Ga0318536_1012439213300031893SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLA
Ga0318536_1021850213300031893SoilMQTNRIYQVQHWPNGQWDRRHNWQEIEAGSEKEAAEKVCGFALKQTGRL
Ga0318522_1031348323300031894SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLAL
Ga0318520_1001164113300031897SoilMQTKRTYQVQHWPNGQWNPEHNWSKIEAASEKEAAEKVCGLA
Ga0310909_1089652823300031947SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTENGTLAQLRARVLT
Ga0306926_1129166323300031954SoilMQTKRIYQVQHWFNGQWDRRQNWQKVEAGSEKEAAEKVCGFAL
Ga0318530_1000963413300031959SoilMQTKRTYQVQHWPDGQWNPEHNWHKIEAASEKEAA
Ga0310911_1027562323300032035SoilMQTRRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLALTANGTLAQLRARVLT
Ga0318556_1047122313300032043SoilMQTNRIYQVQHWPNGQWDRQHNWQKIEAESEKEAAEKVCGFALTQTG
Ga0318506_1029909113300032052SoilMQTKRTYQVQHWPDGQWSPEHNWRKIEANSEKEAAEKVCGLAL
Ga0318514_1039260223300032066SoilMQTRRIYQVQHWPNGQWDRDHNWRKVEAGSEKEAAEKVCG
Ga0306920_10360647113300032261SoilMQTKTTYHVQHWPDGQWNPEHSWQKVEARSEKEAAEK
Ga0306920_10370501513300032261SoilMQTKRIYQVQHWPNGEWDRRHNWQKVEAGTEQEAAEKVCGLALTREGRLAQLRARV
Ga0318519_1018197913300033290SoilMQTKRTYQVQHWPDGQWNPEHNWRKIEAWSEKEAAEKVCGLTLTERGTLAQLRARV
Ga0247829_1020786533300033550SoilMQTQRTYQVQHWPNGQWSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRARRPFR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.