


| Basic Information | |
|---|---|
| Family ID | F077302 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRI |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 19.66 % |
| % of genes near scaffold ends (potentially truncated) | 23.08 % |
| % of genes from short scaffolds (< 2000 bps) | 58.97 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.427 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (12.821 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 12.68% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13671 | AAA_33 | 8.55 |
| PF00149 | Metallophos | 4.27 |
| PF00535 | Glycos_transf_2 | 1.71 |
| PF06067 | DUF932 | 1.71 |
| PF03118 | RNA_pol_A_CTD | 1.71 |
| PF03796 | DnaB_C | 1.71 |
| PF05766 | NinG | 1.71 |
| PF11325 | DUF3127 | 0.85 |
| PF01541 | GIY-YIG | 0.85 |
| PF00929 | RNase_T | 0.85 |
| PF01555 | N6_N4_Mtase | 0.85 |
| PF01569 | PAP2 | 0.85 |
| PF03167 | UDG | 0.85 |
| PF09643 | YopX | 0.85 |
| PF16677 | GP3_package | 0.85 |
| PF06289 | FlbD | 0.85 |
| PF10651 | BppU_N | 0.85 |
| PF02086 | MethyltransfD12 | 0.85 |
| PF02195 | ParBc | 0.85 |
| PF03235 | DUF262 | 0.85 |
| PF14423 | Imm5 | 0.85 |
| PF03869 | Arc | 0.85 |
| PF00574 | CLP_protease | 0.85 |
| PF03013 | Pyr_excise | 0.85 |
| PF01176 | eIF-1a | 0.85 |
| PF03602 | Cons_hypoth95 | 0.85 |
| PF09511 | RNA_lig_T4_1 | 0.85 |
| PF16225 | DUF4884 | 0.85 |
| PF05063 | MT-A70 | 0.85 |
| PF13538 | UvrD_C_2 | 0.85 |
| PF00085 | Thioredoxin | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 1.71 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.71 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.71 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.85 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.85 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.85 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG1582 | Swarming motility protein SwrD | Cell motility [N] | 0.85 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.85 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.85 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.85 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.43 % |
| All Organisms | root | All Organisms | 49.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10007132 | Not Available | 4392 | Open in IMG/M |
| 3300001605|Draft_10487382 | Not Available | 646 | Open in IMG/M |
| 3300001963|GOS2229_1002179 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp. | 1805 | Open in IMG/M |
| 3300002408|B570J29032_109160567 | Not Available | 616 | Open in IMG/M |
| 3300002514|JGI25133J35611_10051915 | All Organisms → Viruses → Predicted Viral | 1379 | Open in IMG/M |
| 3300002835|B570J40625_100082463 | All Organisms → cellular organisms → Bacteria | 4139 | Open in IMG/M |
| 3300003986|Ga0063233_10091683 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300004369|Ga0065726_14647 | Not Available | 16202 | Open in IMG/M |
| 3300005581|Ga0049081_10179050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300005582|Ga0049080_10260156 | Not Available | 565 | Open in IMG/M |
| 3300005758|Ga0078117_1042236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1641 | Open in IMG/M |
| 3300005824|Ga0074474_1574153 | Not Available | 834 | Open in IMG/M |
| 3300005824|Ga0074474_1663128 | Not Available | 960 | Open in IMG/M |
| 3300005825|Ga0074476_1482852 | Not Available | 554 | Open in IMG/M |
| 3300006484|Ga0070744_10014488 | All Organisms → Viruses → Predicted Viral | 2338 | Open in IMG/M |
| 3300006749|Ga0098042_1044445 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300006789|Ga0098054_1359574 | Not Available | 515 | Open in IMG/M |
| 3300006802|Ga0070749_10350026 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola → unclassified Seonamhaeicola → Seonamhaeicola sp. W255 | 821 | Open in IMG/M |
| 3300006810|Ga0070754_10240724 | Not Available | 829 | Open in IMG/M |
| 3300007644|Ga0102902_1192395 | Not Available | 602 | Open in IMG/M |
| 3300007653|Ga0102868_1109925 | Not Available | 635 | Open in IMG/M |
| 3300008113|Ga0114346_1003048 | Not Available | 12017 | Open in IMG/M |
| 3300008266|Ga0114363_1064636 | Not Available | 4345 | Open in IMG/M |
| 3300008470|Ga0115371_10459090 | Not Available | 1911 | Open in IMG/M |
| 3300009081|Ga0105098_10309632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 761 | Open in IMG/M |
| 3300009085|Ga0105103_10678578 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009095|Ga0079224_100292842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2343 | Open in IMG/M |
| 3300009095|Ga0079224_102833565 | Not Available | 692 | Open in IMG/M |
| 3300009128|Ga0118727_1294242 | Not Available | 972 | Open in IMG/M |
| 3300009130|Ga0118729_1055681 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| 3300009149|Ga0114918_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 149006 | Open in IMG/M |
| 3300009149|Ga0114918_10703617 | Not Available | 529 | Open in IMG/M |
| 3300009161|Ga0114966_10075888 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300009165|Ga0105102_10420928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300009165|Ga0105102_10471335 | Not Available | 677 | Open in IMG/M |
| 3300009165|Ga0105102_10690326 | Not Available | 572 | Open in IMG/M |
| 3300009181|Ga0114969_10042563 | All Organisms → Viruses → Predicted Viral | 3075 | Open in IMG/M |
| 3300010148|Ga0098043_1009422 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 3253 | Open in IMG/M |
| 3300010153|Ga0098059_1004562 | Not Available | 6207 | Open in IMG/M |
| 3300010885|Ga0133913_13040511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1117 | Open in IMG/M |
| 3300010932|Ga0137843_1051360 | Not Available | 1679 | Open in IMG/M |
| 3300011188|Ga0136587_1037091 | Not Available | 1184 | Open in IMG/M |
| 3300012346|Ga0157141_1004539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2304 | Open in IMG/M |
| 3300013004|Ga0164293_10054010 | Not Available | 3225 | Open in IMG/M |
| 3300013004|Ga0164293_10091181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028 | 2359 | Open in IMG/M |
| 3300013004|Ga0164293_10158965 | Not Available | 1671 | Open in IMG/M |
| 3300013101|Ga0164313_11699524 | Not Available | 507 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10062072 | Not Available | 2449 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10046974 | All Organisms → Viruses → Predicted Viral | 4243 | Open in IMG/M |
| 3300013295|Ga0170791_15549832 | Not Available | 625 | Open in IMG/M |
| 3300014266|Ga0075359_1110051 | Not Available | 574 | Open in IMG/M |
| 3300014913|Ga0164310_10387477 | Not Available | 824 | Open in IMG/M |
| 3300014962|Ga0134315_1001221 | All Organisms → cellular organisms → Bacteria | 4917 | Open in IMG/M |
| 3300017722|Ga0181347_1007599 | Not Available | 3552 | Open in IMG/M |
| 3300017722|Ga0181347_1071283 | Not Available | 1024 | Open in IMG/M |
| 3300017722|Ga0181347_1142051 | Not Available | 660 | Open in IMG/M |
| 3300017766|Ga0181343_1102398 | Not Available | 813 | Open in IMG/M |
| 3300017774|Ga0181358_1016845 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300017777|Ga0181357_1032780 | Not Available | 2047 | Open in IMG/M |
| 3300017778|Ga0181349_1188734 | Not Available | 719 | Open in IMG/M |
| 3300017780|Ga0181346_1277656 | Not Available | 575 | Open in IMG/M |
| 3300017785|Ga0181355_1059837 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300020048|Ga0207193_1003335 | All Organisms → cellular organisms → Bacteria | 27178 | Open in IMG/M |
| 3300020048|Ga0207193_1067642 | Not Available | 3527 | Open in IMG/M |
| 3300020160|Ga0211733_11049669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X | 554 | Open in IMG/M |
| 3300020205|Ga0211731_10126797 | Not Available | 10255 | Open in IMG/M |
| 3300020388|Ga0211678_10138751 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1050 | Open in IMG/M |
| 3300020519|Ga0208223_1031783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300020573|Ga0208485_1007075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028 | 2670 | Open in IMG/M |
| 3300021962|Ga0222713_10002600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19192 | Open in IMG/M |
| 3300021963|Ga0222712_10058813 | Not Available | 2828 | Open in IMG/M |
| 3300021963|Ga0222712_10614972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 625 | Open in IMG/M |
| 3300022206|Ga0224499_10000228 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 14019 | Open in IMG/M |
| 3300022206|Ga0224499_10238684 | Not Available | 617 | Open in IMG/M |
| 3300022407|Ga0181351_1002023 | All Organisms → cellular organisms → Bacteria | 6881 | Open in IMG/M |
| 3300022407|Ga0181351_1131675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300023184|Ga0214919_10022385 | All Organisms → cellular organisms → Bacteria | 6982 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10000170 | Not Available | 8704 | Open in IMG/M |
| 3300024262|Ga0210003_1000004 | Not Available | 494080 | Open in IMG/M |
| 3300024346|Ga0244775_10012192 | All Organisms → cellular organisms → Bacteria | 8114 | Open in IMG/M |
| 3300024346|Ga0244775_10496190 | Not Available | 998 | Open in IMG/M |
| 3300024358|Ga0255173_1000468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 8932 | Open in IMG/M |
| 3300024506|Ga0255168_1031138 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300024549|Ga0256308_1040948 | Not Available | 1004 | Open in IMG/M |
| 3300025109|Ga0208553_1000536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 13519 | Open in IMG/M |
| 3300025131|Ga0209128_1174659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 625 | Open in IMG/M |
| 3300027145|Ga0255114_1015328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1541 | Open in IMG/M |
| 3300027503|Ga0255182_1048347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 1113 | Open in IMG/M |
| 3300027608|Ga0208974_1160421 | Not Available | 565 | Open in IMG/M |
| 3300027683|Ga0209392_1001485 | Not Available | 6118 | Open in IMG/M |
| 3300027707|Ga0209443_1018751 | Not Available | 3121 | Open in IMG/M |
| 3300027754|Ga0209596_1268894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 691 | Open in IMG/M |
| 3300027798|Ga0209353_10340533 | Not Available | 628 | Open in IMG/M |
| 3300027836|Ga0209230_10094549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus | 1652 | Open in IMG/M |
| 3300027892|Ga0209550_10681373 | Not Available | 594 | Open in IMG/M |
| 3300027956|Ga0209820_1159606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 624 | Open in IMG/M |
| 3300027963|Ga0209400_1028487 | All Organisms → Viruses → Predicted Viral | 3142 | Open in IMG/M |
| 3300028361|Ga0306872_100198 | All Organisms → cellular organisms → Bacteria | 26170 | Open in IMG/M |
| 3300028394|Ga0304730_1028693 | Not Available | 2908 | Open in IMG/M |
| 3300028920|Ga0272441_10008315 | All Organisms → cellular organisms → Bacteria | 16472 | Open in IMG/M |
| 3300031539|Ga0307380_10644599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter → Telluribacter humicola | 903 | Open in IMG/M |
| 3300031565|Ga0307379_10525935 | Not Available | 1100 | Open in IMG/M |
| 3300031645|Ga0307990_1185854 | Not Available | 830 | Open in IMG/M |
| 3300031786|Ga0315908_11503641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300031885|Ga0315285_10143227 | Not Available | 2000 | Open in IMG/M |
| 3300031951|Ga0315904_10934057 | Not Available | 696 | Open in IMG/M |
| 3300031952|Ga0315294_11189441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 620 | Open in IMG/M |
| 3300032061|Ga0315540_10126962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1152 | Open in IMG/M |
| 3300032092|Ga0315905_10188755 | Not Available | 2036 | Open in IMG/M |
| 3300033984|Ga0334989_0012967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus | 4331 | Open in IMG/M |
| 3300033996|Ga0334979_0029761 | Not Available | 3642 | Open in IMG/M |
| 3300034013|Ga0334991_0093452 | All Organisms → Viruses → Predicted Viral | 1459 | Open in IMG/M |
| 3300034013|Ga0334991_0254803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 731 | Open in IMG/M |
| 3300034102|Ga0335029_0003877 | All Organisms → cellular organisms → Bacteria | 11877 | Open in IMG/M |
| 3300034112|Ga0335066_0055114 | All Organisms → Viruses → Predicted Viral | 2636 | Open in IMG/M |
| 3300034118|Ga0335053_0113266 | Not Available | 1864 | Open in IMG/M |
| 3300034200|Ga0335065_0867560 | Not Available | 500 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.13% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.56% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.56% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.56% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.56% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.71% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.71% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.71% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.71% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.71% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.71% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.85% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.85% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.85% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.85% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.85% |
| Subsea Pool | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009128 | Combined Assembly of Gp0137084, Gp0137083 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010932 | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 | Environmental | Open in IMG/M |
| 3300011188 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028361 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031645 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100071323 | 3300001282 | Freshwater | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGNWFWRTRKIKE* |
| Draft_104873822 | 3300001605 | Hydrocarbon Resource Environments | MLTVAERRFFIWKLELWWIAFDSVEFHPEGRKHLKNNWFWRT* |
| GOS2229_10021794 | 3300001963 | Marine | MEVNVAQRRFFIWKLELWWIALDSPQFYPDGRKHLKGNWFWRQ* |
| B570J29032_1091605672 | 3300002408 | Freshwater | MKEYNVAQRKFFIWKLELWWIAFNSAEFYPENRKHLKWNWFWRI* |
| JGI25133J35611_100519152 | 3300002514 | Marine | MEVNVAQRRFYIWKLELWWIAFGSPQFYPENRKHIKGNWFWRQ* |
| B570J40625_1000824632 | 3300002835 | Freshwater | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGIGSGEPEK* |
| Ga0063233_100916833 | 3300003986 | Freshwater Lake | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK* |
| Ga0065726_146477 | 3300004369 | Saline | VAVRLFHIWKLEYWWVAFDLQDFYPKGRKHLKGKWFWRKIKKNEDI* |
| Ga0049081_101790502 | 3300005581 | Freshwater Lentic | MSTFKVAERLFYIWKLERWWIAFDDDAFYPEDRKHLTGNWFWRI* |
| Ga0049080_102601562 | 3300005582 | Freshwater Lentic | MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI* |
| Ga0078117_10422364 | 3300005758 | Lake Water | MYVNVAQRRFYIWKIELWWIAFDKTEFYPEGRKHLKGNWFWRT* |
| Ga0074474_15741533 | 3300005824 | Sediment (Intertidal) | MEVNVAQRKIYIWKLELWWIAFGSSQFYPEGRKHIKGNWFWKQ* |
| Ga0074474_16631281 | 3300005824 | Sediment (Intertidal) | QRKIYIWKLELWWIAFGSPQFYPNGRSHLKGGWFWRK* |
| Ga0074476_14828523 | 3300005825 | Sediment (Intertidal) | MEVNVAQRKIYIWKLELWWIAFGSPQFYPNGRSHLKGGWFWRK* |
| Ga0070744_100144882 | 3300006484 | Estuarine | MKEYIVNQRRFFIWKLELWWIAFDSVEFYPEDRKHLRGNWFWRN* |
| Ga0098042_10444454 | 3300006749 | Marine | MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTTKPQ* |
| Ga0098054_13595742 | 3300006789 | Marine | MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRAHIKGNWFWR* |
| Ga0070749_103500264 | 3300006802 | Aqueous | MEVNVAQRRFFIWKLELWWIAFDSPQFYPEGRKQIKGNWFWRQ* |
| Ga0070754_102407242 | 3300006810 | Aqueous | MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRSHIKGNWFWRQ* |
| Ga0102902_11923952 | 3300007644 | Estuarine | MLEYNVSERIFFIWKLELWWIAFDHPQFYPEGRKHL |
| Ga0102868_11099251 | 3300007653 | Estuarine | MKEYIVNQRRFHIWKLELWWVAFDSQQFYPDGRTKLKGNWFWRNNCNL |
| Ga0114346_100304830 | 3300008113 | Freshwater, Plankton | MLEYNVSERIFFIWKLEYWWIAFDHPQFHPDDRKHLRGNWFWRTKK* |
| Ga0114363_10646362 | 3300008266 | Freshwater, Plankton | MMMTVNERRFYIWKLELWWVAFNSVEFYPEHRKHLINNWFWRT* |
| Ga0115371_104590905 | 3300008470 | Sediment | MEVNVAQRRFFIWKLELWWIALESASFYPDGRKHLKGNWFWRTQKNKN |
| Ga0105098_103096322 | 3300009081 | Freshwater Sediment | MEYNVAQRRFFIWKLELWWIAFDDNAFHPKNRIHLTGNWFWRI* |
| Ga0105103_106785782 | 3300009085 | Freshwater Sediment | AERIFYIWKLEYWWIAFDRVEFYPEGRKHLRGNWFWRK* |
| Ga0079224_1002928424 | 3300009095 | Agricultural Soil | MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRI* |
| Ga0079224_1028335652 | 3300009095 | Agricultural Soil | MTNKKTKFMVNVAERTFYIWKLEYWWIAFDKPAFYPEGRKHLKGGWFWRK* |
| Ga0118727_12942423 | 3300009128 | Marine | MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWRQ* |
| Ga0118729_10556817 | 3300009130 | Marine | MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWR |
| Ga0114918_1000001612 | 3300009149 | Deep Subsurface | MEVSVAQRRFYIWKLELWWIAFDSPQFYPEDRNHIKGNWFWRS* |
| Ga0114918_107036171 | 3300009149 | Deep Subsurface | MDVITGERKFFIWKLEWWWIVFDKEEFYPEGRAHIKGNMFWRK* |
| Ga0114966_100758883 | 3300009161 | Freshwater Lake | MLEYNVSERRFFIWKLELWWIAFDHPQFYPDGRKYLRGNWFWRTKK* |
| Ga0105102_104209281 | 3300009165 | Freshwater Sediment | KRRFHIWKLELWWVAFNKVEFHPEDRKHLIGNWFWRT* |
| Ga0105102_104713352 | 3300009165 | Freshwater Sediment | MLELNVAQRRFFIWKLELWWIAFDKAEFHPEGRKHLKGNWFWRQ* |
| Ga0105102_106903261 | 3300009165 | Freshwater Sediment | MKDYIVNERRFYIWKLELWYVAFNDSQFYPDCRVKLKGNW |
| Ga0114969_100425638 | 3300009181 | Freshwater Lake | MYTIAQRRFYIWKLELWWIAFDDDAFHPKNRIHLIGNWFWRL* |
| Ga0098043_10094223 | 3300010148 | Marine | MKVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTNKPQ* |
| Ga0098059_10045622 | 3300010153 | Marine | MEVNVAQRRFYVWKLELWWVAFDSPQFYPVSRKHIKGNWFWRQ* |
| Ga0133913_130405112 | 3300010885 | Freshwater Lake | MYTVAQRRFYIWKLELWWIAFDDDAFHPEGRKHIKGNWFWRI* |
| Ga0137843_10513601 | 3300010932 | Subsea Pool | MKVNVAQRRFYIWKLELWWIAFDISKFYPKGRKYIKGNWFWRQ* |
| Ga0136587_10370914 | 3300011188 | Saline Lake | MVTINERTFYIWKLEFWWVAFNKEEFYPEDRKHLFKNVFWRI* |
| Ga0157141_10045393 | 3300012346 | Freshwater | MYTVAERIFYIWRLEFWWVAFNDVGFYPEDRKHLKGRWFWRK* |
| Ga0164293_1005401012 | 3300013004 | Freshwater | MITVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT* |
| Ga0164293_100911811 | 3300013004 | Freshwater | MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRQ* |
| Ga0164293_101589652 | 3300013004 | Freshwater | MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDRKHLKGNWFWRT* |
| Ga0164313_116995241 | 3300013101 | Marine Sediment | MVNVGQRIFFIWKLELWWIAFDDPQFYPDDRTHIKGHWFWRH* |
| (restricted) Ga0172365_100620722 | 3300013127 | Sediment | MVNVAEREFYIWKLEFWWIAFDKEEFYPAGRIHIKGGWFWRR* |
| (restricted) Ga0172372_100469746 | 3300013132 | Freshwater | MIIVSERRFYIWKLELWWIAFNSVEFHPEDRKHLRGNWFWRT* |
| Ga0170791_155498323 | 3300013295 | Freshwater | RQYTVAQRRFYIWKLELWWIAFDSPQFYPDGRKQLKGNWFWRT* |
| Ga0075359_11100512 | 3300014266 | Natural And Restored Wetlands | MFEVNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM* |
| Ga0164310_103874772 | 3300014913 | Marine Sediment | MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTNKPQ* |
| Ga0134315_100122110 | 3300014962 | Surface Water | MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKDNWFWRM* |
| Ga0181347_100759910 | 3300017722 | Freshwater Lake | VSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK |
| Ga0181347_10712831 | 3300017722 | Freshwater Lake | VSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE |
| Ga0181347_11420513 | 3300017722 | Freshwater Lake | KVAERVFYIWKLERWWIAFDDDAFYPEDRKHLIGNWFWRT |
| Ga0181343_11023984 | 3300017766 | Freshwater Lake | MITVAERKFYIWRLEFWWVAFNIAEYYPEDRKHLKGGWFWRK |
| Ga0181358_10168452 | 3300017774 | Freshwater Lake | MEYNVAQRRFFIWKLELWWIAFDDDAFYPKNRIHLIGNWFWRI |
| Ga0181357_10327803 | 3300017777 | Freshwater Lake | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE |
| Ga0181349_11887342 | 3300017778 | Freshwater Lake | MKEYNVAQRLFYIWKLELWWIAFNSVELYPEDRKHLRG |
| Ga0181346_12776561 | 3300017780 | Freshwater Lake | IWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE |
| Ga0181355_10598373 | 3300017785 | Freshwater Lake | MEYNVAQRRFFIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI |
| Ga0207193_100333564 | 3300020048 | Freshwater Lake Sediment | MYNSAERIFYIWKLEYWWIAFDRVEFYPEGRKHLRGNWFWRK |
| Ga0207193_10676424 | 3300020048 | Freshwater Lake Sediment | MKVVSERQFYIWKLEFWWVAFNALEFYPKDRKPLGHNWFWRK |
| Ga0211733_110496691 | 3300020160 | Freshwater | MLEYKVSQRRFFIWKLEYWWIAFDHPQFYPDGRNYLRGNWFWRAKKIKKII |
| Ga0211731_101267977 | 3300020205 | Freshwater | MYINSAERIFYIWKLELWWIAFDKAYFYPEGRKHLRGNWFWRTKKNKK |
| Ga0211678_101387512 | 3300020388 | Marine | MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWRQ |
| Ga0208223_10317831 | 3300020519 | Freshwater | AQRKFFIWKLELWWIAFNSAEFYPENRKHLKWNWFWRI |
| Ga0208485_10070754 | 3300020573 | Freshwater | MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRQ |
| Ga0222713_1000260032 | 3300021962 | Estuarine Water | MEYNVAQRRFFIWKLELWWIAFDDDAFHPKNRIHLIGKWFWRI |
| Ga0222712_100588136 | 3300021963 | Estuarine Water | MKEYIVNQRRFHIWKLELWWVAFDSPQFYPDGRTKLKGNWFWRNYCNL |
| Ga0222712_106149721 | 3300021963 | Estuarine Water | MLEYNASERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGNWFWRTRKIKD |
| Ga0224499_100002286 | 3300022206 | Sediment | MEVNVAQRRFYIWKLELWWIAFDSPRFYPEGRKHIKGNWFWRQ |
| Ga0224499_102386842 | 3300022206 | Sediment | MEVNVAQRRFYIWKLELWWIAFDSPQFYPEGRKHIKGN |
| Ga0181351_10020235 | 3300022407 | Freshwater Lake | MSTFNVAERLFYIWKLEKWWIAFDSVEFYPEDRKHLVGNWFWRI |
| Ga0181351_11316751 | 3300022407 | Freshwater Lake | WKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE |
| Ga0214919_100223853 | 3300023184 | Freshwater | MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWRI |
| (restricted) Ga0255050_1000017019 | 3300024052 | Seawater | MEVNVAKRRFYIWKIELWWIAFDSPQFYPEDRSHIKGNWFWRQ |
| Ga0210003_1000004578 | 3300024262 | Deep Subsurface | MEVSVAQRRFYIWKLELWWIAFDSPQFYPEDRNHIKGNWFWRS |
| Ga0244775_1001219219 | 3300024346 | Estuarine | MKEYIVNQRRFFIWKLELWWIAFDSVEFYPEDRKHLRGNWFWRN |
| Ga0244775_104961902 | 3300024346 | Estuarine | MLEYNVAVRRLYIWKLELWWIAFDSPQFYPEGRTHLKGNWFWRNRKDKK |
| Ga0255173_10004687 | 3300024358 | Freshwater | MLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM |
| Ga0255168_10311383 | 3300024506 | Freshwater | MLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWF |
| Ga0256308_10409483 | 3300024549 | Freshwater | MSTFKVAERRFFIWKLELWWIAFDDDAFYPEDRRHLIGNWFWRI |
| Ga0208553_100053637 | 3300025109 | Marine | MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTTKPQ |
| Ga0209128_11746591 | 3300025131 | Marine | MEVNVAQRRFYIWKLELWWIAFGSPQFYPENRKHIKGNWFWRQ |
| Ga0255114_10153281 | 3300027145 | Freshwater | MLEYNVSERIFFIWKLEYWWIAFDHPQFHPEDRKHL |
| Ga0255182_10483471 | 3300027503 | Freshwater | AVKITIMLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM |
| Ga0208974_11604213 | 3300027608 | Freshwater Lentic | MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI |
| Ga0209392_10014855 | 3300027683 | Freshwater Sediment | MKDYIVNERRFYIWKLELWYVAFNDSQFYPDCRVKLKGNWFWRK |
| Ga0209443_10187512 | 3300027707 | Freshwater Lake | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK |
| Ga0209596_12688942 | 3300027754 | Freshwater Lake | MYTVAQRRFYIWKLELWWIAFDDDAFHPEGRKHIKGNWFWRI |
| Ga0209353_103405331 | 3300027798 | Freshwater Lake | VMYVAEREFYIWKLEKWWIAFDDDAFHPKNRVHLIGNWFWRI |
| Ga0209230_100945493 | 3300027836 | Freshwater And Sediment | MYVAEREFYIWKLEKWWIAFDDDAFHPKNRVHLIGNWFWRI |
| Ga0209550_106813731 | 3300027892 | Freshwater Lake | MYTVAQRRFFIWKLELWWIAFDSCEFYPEGRKQLKGNWFW |
| Ga0209820_11596062 | 3300027956 | Freshwater Sediment | MEYNVAQRRFFIWKLELWWIAFDDNAFHPKNRIHLTGNWFWRI |
| Ga0209400_10284873 | 3300027963 | Freshwater Lake | MLEYNVSERRFFIWKLELWWIAFDHPQFYPDGRKHLRGNWFWRTKK |
| Ga0306872_10019839 | 3300028361 | Saline Lake | MVTINERTFYIWKLEFWWVAFNKEEFYPEDRKHLFKNVFWRI |
| Ga0304730_102869310 | 3300028394 | Freshwater Lake | MYTIAQRRFYIWKLELWWIAFDDDAFHPKNRIHLIGNWFWRL |
| Ga0272441_1000831525 | 3300028920 | Marine Sediment | MLNLIVAKRRFYIWKLELWWIAFNSPEFYPKGRINIKGNWFWRL |
| Ga0307380_106445992 | 3300031539 | Soil | MDVIVSQRKFFIWKLELWWIAFDKIEFHPSGRGHIKGNWFWRK |
| Ga0307379_105259351 | 3300031565 | Soil | MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRSHIKGNWFWRQ |
| Ga0307990_11858541 | 3300031645 | Marine | MDLNVAQRRFYIGKLEFWWIAFNSNEFYPKGRKQLKGN |
| Ga0315908_115036411 | 3300031786 | Freshwater | MYTVAQRRFFIWKLELWWIAFDSCEFYPEGCKQLKGN |
| Ga0315285_101432275 | 3300031885 | Sediment | MVELNVAQRRLFIWKLELWWIAFDKAEFYPEGRKHLRGSWFWRQ |
| Ga0315904_109340571 | 3300031951 | Freshwater | VNVAQRRFFVWKLELWWVAFDKAEFYPEGRKHLKGNWFWRT |
| Ga0315294_111894412 | 3300031952 | Sediment | MSTFNVAERLFYIWKLEKWWIAFDSVEFYPEDRKHLVGNWFWRT |
| Ga0315540_101269623 | 3300032061 | Salt Marsh Sediment | MINVAIREFYIWKLEYWWIALDNPQFYPEDRIHLFKNWFWRK |
| Ga0315905_101887555 | 3300032092 | Freshwater | MLEYNVSERIFFIWKLEYWWIAFDHPQFYPDDRKHLRGNWFWRTKKIKE |
| Ga0334989_0012967_3340_3471 | 3300033984 | Freshwater | MKYNVAQRRFFIWKLELWWIAFDNDAFHPKNRIHLIGNWFWRI |
| Ga0334979_0029761_782_910 | 3300033996 | Freshwater | MITVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT |
| Ga0334991_0093452_570_704 | 3300034013 | Freshwater | MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDRKHLKGNWFWRT |
| Ga0334991_0254803_278_418 | 3300034013 | Freshwater | MSTFKVAERVFYIWKLERWWIAFGDDAFYPSNRKHLIGNWFWRTKK |
| Ga0335029_0003877_11093_11227 | 3300034102 | Freshwater | MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDIKHLKGNWFWRT |
| Ga0335066_0055114_2438_2572 | 3300034112 | Freshwater | MLELNVAQRRFFIWKLELWWIAFDKAEFSPEGRKHLKGNWFWRQ |
| Ga0335053_0113266_1741_1863 | 3300034118 | Freshwater | TVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT |
| Ga0335065_0867560_1_111 | 3300034200 | Freshwater | MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLK |
| ⦗Top⦘ |