NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077269

Metagenome / Metatranscriptome Family F077269

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077269
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence PCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Number of Associated Samples 87
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.44 %
% of genes from short scaffolds (< 2000 bps) 91.45 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.034 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(43.590 % of family members)
Environment Ontology (ENVO) Unclassified
(44.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.590 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.68%    β-sheet: 0.00%    Coil/Unstructured: 87.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF05016ParE_toxin 11.97
PF01381HTH_3 11.97
PF06718DUF1203 9.40
PF00072Response_reg 7.69
PF00486Trans_reg_C 5.13
PF05973Gp49 4.27
PF00196GerE 1.71
PF01177Asp_Glu_race 1.71
PF02311AraC_binding 1.71
PF00202Aminotran_3 1.71
PF05960DUF885 1.71
PF01925TauE 0.85
PF00581Rhodanese 0.85
PF00583Acetyltransf_1 0.85
PF13472Lipase_GDSL_2 0.85
PF04542Sigma70_r2 0.85
PF05899Cupin_3 0.85
PF02036SCP2 0.85
PF13360PQQ_2 0.85
PF08327AHSA1 0.85
PF02129Peptidase_S15 0.85
PF00005ABC_tran 0.85
PF16640Big_3_5 0.85
PF00498FHA 0.85
PF01547SBP_bac_1 0.85
PF03704BTAD 0.85
PF11975Glyco_hydro_4C 0.85
PF13367PrsW-protease 0.85
PF04116FA_hydroxylase 0.85
PF14200RicinB_lectin_2 0.85
PF01266DAO 0.85
PF10009DUF2252 0.85
PF01425Amidase 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 4.27
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 4.27
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 1.71
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.85
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.85
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.85
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.85
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.85
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.85
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.85
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.03 %
UnclassifiedrootN/A11.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_108990148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales651Open in IMG/M
3300005332|Ga0066388_107094528Not Available563Open in IMG/M
3300005435|Ga0070714_100070024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3031Open in IMG/M
3300005435|Ga0070714_100692731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus983Open in IMG/M
3300005445|Ga0070708_101305430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300005610|Ga0070763_10493284All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005764|Ga0066903_102673585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium968Open in IMG/M
3300005764|Ga0066903_102680765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia967Open in IMG/M
3300005764|Ga0066903_102896273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii930Open in IMG/M
3300005764|Ga0066903_103531362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300005764|Ga0066903_103894166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia801Open in IMG/M
3300005901|Ga0075274_1054358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300006576|Ga0074047_11990301All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006804|Ga0079221_11802694Not Available501Open in IMG/M
3300006806|Ga0079220_10671447All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300006854|Ga0075425_100431557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1517Open in IMG/M
3300006854|Ga0075425_102071124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales635Open in IMG/M
3300007076|Ga0075435_101809930Not Available536Open in IMG/M
3300010358|Ga0126370_12501603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae514Open in IMG/M
3300010359|Ga0126376_11456571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium712Open in IMG/M
3300010366|Ga0126379_10349507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1508Open in IMG/M
3300010366|Ga0126379_11288242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba837Open in IMG/M
3300010376|Ga0126381_102837691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura691Open in IMG/M
3300010376|Ga0126381_103340876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii632Open in IMG/M
3300010398|Ga0126383_12835480Not Available566Open in IMG/M
3300010398|Ga0126383_13389427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300010937|Ga0137776_1112831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1210Open in IMG/M
3300011271|Ga0137393_10064831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2895Open in IMG/M
3300012211|Ga0137377_10039324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4330Open in IMG/M
3300012285|Ga0137370_10194757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1187Open in IMG/M
3300012285|Ga0137370_10391879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba840Open in IMG/M
3300012363|Ga0137390_10137271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2426Open in IMG/M
3300012363|Ga0137390_10310288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium1559Open in IMG/M
3300012971|Ga0126369_11477585All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300012971|Ga0126369_11679954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura724Open in IMG/M
3300012971|Ga0126369_12186503Not Available640Open in IMG/M
3300013772|Ga0120158_10357069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium685Open in IMG/M
3300016341|Ga0182035_10359094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1213Open in IMG/M
3300016357|Ga0182032_10053750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha2627Open in IMG/M
3300016371|Ga0182034_11195322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura661Open in IMG/M
3300016387|Ga0182040_10146737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha1675Open in IMG/M
3300016445|Ga0182038_10302983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1307Open in IMG/M
3300017926|Ga0187807_1178015All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300017955|Ga0187817_10505459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300018032|Ga0187788_10440485All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300020580|Ga0210403_10488626All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300020581|Ga0210399_10616231All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300020581|Ga0210399_11430393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300020582|Ga0210395_10934096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300021374|Ga0213881_10109771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium1197Open in IMG/M
3300021404|Ga0210389_10214022All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300021404|Ga0210389_10708774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium788Open in IMG/M
3300021407|Ga0210383_10623742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300021407|Ga0210383_11693651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300021479|Ga0210410_10809889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300021560|Ga0126371_11957839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba704Open in IMG/M
3300021560|Ga0126371_12260871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium657Open in IMG/M
3300021560|Ga0126371_12999164Not Available572Open in IMG/M
3300021560|Ga0126371_13421734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300021860|Ga0213851_1448833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300025912|Ga0207707_10776634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae800Open in IMG/M
3300025915|Ga0207693_10236428All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300025929|Ga0207664_10951915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii770Open in IMG/M
3300025939|Ga0207665_10000276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria35590Open in IMG/M
3300027908|Ga0209006_10851767All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300028803|Ga0307281_10404832Not Available523Open in IMG/M
3300030511|Ga0268241_10196578Not Available511Open in IMG/M
3300031474|Ga0170818_108431481All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300031544|Ga0318534_10625651Not Available611Open in IMG/M
3300031546|Ga0318538_10201090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1064Open in IMG/M
3300031546|Ga0318538_10458144Not Available691Open in IMG/M
3300031549|Ga0318571_10180012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium746Open in IMG/M
3300031573|Ga0310915_10013666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha4782Open in IMG/M
3300031680|Ga0318574_10804649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium551Open in IMG/M
3300031713|Ga0318496_10049771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2166Open in IMG/M
3300031713|Ga0318496_10677131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii569Open in IMG/M
3300031723|Ga0318493_10083340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1579Open in IMG/M
3300031736|Ga0318501_10443444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300031744|Ga0306918_10159993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha1670Open in IMG/M
3300031748|Ga0318492_10780907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300031751|Ga0318494_10439179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300031769|Ga0318526_10046674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300031782|Ga0318552_10331184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii775Open in IMG/M
3300031793|Ga0318548_10112159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300031794|Ga0318503_10075234Not Available1055Open in IMG/M
3300031796|Ga0318576_10475225Not Available590Open in IMG/M
3300031796|Ga0318576_10539213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300031797|Ga0318550_10213629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium934Open in IMG/M
3300031799|Ga0318565_10168249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300031821|Ga0318567_10052747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2106Open in IMG/M
3300031832|Ga0318499_10187247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba807Open in IMG/M
3300031835|Ga0318517_10063304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha1574Open in IMG/M
3300031890|Ga0306925_11233290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300031896|Ga0318551_10678594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300031947|Ga0310909_10681339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii855Open in IMG/M
3300031947|Ga0310909_11343662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300031954|Ga0306926_11741823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300032035|Ga0310911_10093449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300032035|Ga0310911_10576837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300032055|Ga0318575_10279414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300032055|Ga0318575_10281571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300032059|Ga0318533_10820798Not Available682Open in IMG/M
3300032064|Ga0318510_10337377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300032065|Ga0318513_10673413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300032066|Ga0318514_10105060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1436Open in IMG/M
3300032068|Ga0318553_10246348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba933Open in IMG/M
3300032068|Ga0318553_10348661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300032068|Ga0318553_10390106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300032076|Ga0306924_12566417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300032091|Ga0318577_10263174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii826Open in IMG/M
3300032091|Ga0318577_10288509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba785Open in IMG/M
3300032091|Ga0318577_10427732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300032174|Ga0307470_10727178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300032261|Ga0306920_103061774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300032261|Ga0306920_103266361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura605Open in IMG/M
3300033290|Ga0318519_10943216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil43.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.85%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10899014813300000955SoilSFAAFCRHVYSGPDGFAAVKFDVNLDGRVFLPCPRGR*
Ga0066388_10709452823300005332Tropical Forest SoilQCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT*
Ga0070714_10007002413300005435Agricultural SoilGQSCPPKRRFATFCRIVYAPPYGFAAVKFDVDLNGKMFYPCPRGT*
Ga0070714_10069273113300005435Agricultural SoilCPRKRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT*
Ga0070708_10130543023300005445Corn, Switchgrass And Miscanthus RhizosphereDHYVCNPGQPCPGKRRFATFCRLVYAPSYGFAAVKFDVNLDGKIFYPCPRGT*
Ga0070763_1049328413300005610SoilSYAAFCRALYDPPLGFAAVKFDVDLDGRVFYPCPRGT*
Ga0066903_10267358533300005764Tropical Forest SoilTFCRVVYAPSYGFTAIKFDVNLDGKYFYPCPRGT*
Ga0066903_10268076523300005764Tropical Forest SoilATFCARVYAPPGGFAAVKFDVDLDGKVFYPCPTGT*
Ga0066903_10289627313300005764Tropical Forest SoilKRRFATFCRVVYAPSYGFTAVKFDVNLDGKTFYPCPHGT*
Ga0066903_10353136213300005764Tropical Forest SoilKNFSTFCRIVYAPSYGYSAVKFNVNLDGSMFHPCPRGT*
Ga0066903_10389416613300005764Tropical Forest SoilRRFATFCRIVYAPPGGFAAVKFDVDLNGKVFYPCPRGT*
Ga0075274_105435823300005901Rice Paddy SoilQHRFSSFCHIVYAPADGFAAVKLNVNLDGTMFYPCPRGG*
Ga0074047_1199030113300006576SoilFATFCARVYAPPDGFAAVKFDVNLDGKVFEPCPAGT*
Ga0079221_1180269423300006804Agricultural SoilGQSCPPKRRFATFCRIIYAPPGGFSAVKFDVDLNGKMFYPCPRGT*
Ga0079220_1067144723300006806Agricultural SoilGRRCPPQREFSTFCHTVYSPPRGFAAVKLDVNLDGKTFFPCP*
Ga0075425_10043155753300006854Populus RhizosphereDHYVCNPGQPCQGKRSFATFCRLVWGAPGGFSAVKFDVNLDGKVFYPCPRGT*
Ga0075425_10207112433300006854Populus RhizosphereDHYVCNPGQPCQGKRSFATFCRLVWGAPGGFSAVKFDVNLNGKVFYPCPRGT*
Ga0075435_10180993023300007076Populus RhizosphereAYCRRIYDGKNGFAAVKFDVNLDGRTFYPCPRGR*
Ga0126370_1250160313300010358Tropical Forest SoilCTGGRSFAVFCRKIWAPAYGFAAVKFDVNLDGKVFFPCPRGV*
Ga0126376_1145657123300010359Tropical Forest SoilFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT*
Ga0126379_1034950733300010366Tropical Forest SoilPHRFATFCRAIYAPADGFAAVKFDVNLDGKMFYPCPRGI*
Ga0126379_1128824233300010366Tropical Forest SoilNPGQPCQGKRSFATFCRLVWGRAGGFSAIKFDVNLDGKVFYPCPRGT*
Ga0126381_10283769113300010376Tropical Forest SoilPGQPCPPKRRFATFCRVVYAPPPYGFSAVKFDVNLNGKIFYPCPRGT*
Ga0126381_10334087613300010376Tropical Forest SoilGADHYVCNPGQNCPRKRRFATFCRLVYAPSYGFAAVKFDVNLDGKTFYPCPRGT*
Ga0126383_1283548023300010398Tropical Forest SoilFATFCRAIYAPADGFSAVKFDVNLDGKMFYPCPRGI*
Ga0126383_1338942733300010398Tropical Forest SoilCPGKRRFATFCRLVWGRPGGFSAVKFDVDLNGKVFYPCPRGT*
Ga0137776_111283113300010937SedimentVCNPGQSCPPKRRFATFCRLVYAPPYGFTAIKFDVNLDAKTFYPCPNGT*
Ga0137393_1006483133300011271Vadose Zone SoilVSGQTSFATFCRLVYGSPGGFSAVKFDVNLDGKVFYPCPRGT*
Ga0137377_1003932453300012211Vadose Zone SoilCPHGRKTFAAFCRAVYAGPQGYAAVKFGVNLDGKVFLPCPRGR*
Ga0137370_1019475723300012285Vadose Zone SoilCNPGQSCPPKRRFATFCRVVYAPPGGFSAVKFDVDLNGKMFYPCPRGT*
Ga0137370_1039187933300012285Vadose Zone SoilKRSFATFCRLVWGAPGGFSAVKFDVDLNGKVFYPCPRGT*
Ga0137390_1013727133300012363Vadose Zone SoilAKCTGKHSFAAFCRAVYAPPLGFAAVKFDVNLDGKVFYPCPRGT*
Ga0137390_1031028813300012363Vadose Zone SoilNPGRSCPPKRRFATFCRVVYAPPGGFSAVKFDVDLNGKMFYPCPRGT*
Ga0126369_1147758513300012971Tropical Forest SoilFATFCRIIYAPPGGFSAVKFDVDLNGKVFYPCPRGT*
Ga0126369_1167995423300012971Tropical Forest SoilATFCRVVYAPSYGFAAVKFDVNLDGRTFHPCPHGT*
Ga0126369_1218650323300012971Tropical Forest SoilTFCARVYAPPGGFAAVKFDVDLDGKVFYPCPTGT*
Ga0120158_1035706913300013772PermafrostHQRAFATFCAANYAPSYGFSAVKFDVNLDGKTFFPCPKGA*
Ga0182035_1035909413300016341SoilSCPPKRRFATFCAVVYAPPGGFSAVKFDVNLNGKLFYPCPRGT
Ga0182032_1005375063300016357SoilNPGQPCPGPRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0182034_1119532213300016371SoilQSCPPKRRFATFCRIVYAPPGGFSAVKFDVDLNGKMFFPCPRGT
Ga0182040_1014673753300016387SoilRRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0182038_1030298343300016445SoilYVCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0187807_117801523300017926Freshwater SedimentDGYVCNPGQSCAGRRSFSAFCRAVYAPSYGFAAVKFDVNLDGAMFYPCPKGV
Ga0187817_1050545913300017955Freshwater SedimentKFATFCRSIYAPSYGFAAVKLDVNLDGSLFYPCPSGI
Ga0187788_1044048523300018032Tropical PeatlandSTYCSIVYGRVSGFAAVKFDVNLDGSLFYPCPNGT
Ga0210403_1048862613300020580SoilDHYVCNPGQTGQKCTGRRSFAAFCASVYQPSYGFAAVKFDVNLDGKMFFPCPHGS
Ga0210399_1061623123300020581SoilTGQKCTGRRSFAAFCASVYQPSYGFAAVKFDVNLDGKMFFPYPHGS
Ga0210399_1143039313300020581SoilRRFATFCRLVWGPSGGFSAVKFDVNLDGKVFYPCPRGT
Ga0210395_1093409623300020582SoilCPAKRRFATFCRIVYAPPYGFSAVKFDVNLDGKMFYPCPRGT
Ga0210388_1040056323300021181SoilCNPGQTSKKCAGRRSFAAFCAAVYQPSYGFSAVKFDVDLDGKMFFPCPRGT
Ga0213881_1010977133300021374Exposed RockYVCDPGQRCGYSHRFSTFCRIVYGSPGGFSAVKFNVNLDGSVFYPCPTGR
Ga0210389_1021402213300021404SoilCDPGQACSGRRSFAAFCRAVYSPSYGFAAVKFDVDLDGGKFYPCPTGT
Ga0210389_1070877423300021404SoilYVCNPGQRCPVPRRFATFCQRVWAPAYGFAAVKFDVDLDGRMFFPCPRGR
Ga0210383_1062374213300021407SoilNPGQPCPAKRRFATFCRIVYAPPYGFSAVKFDVNLDGKMFYPCPRGT
Ga0210383_1169365113300021407SoilNPGQHCSHKKNFSTFCHTVYAPPYGYSAVKFNVNLDGTMFYPCPKGT
Ga0210410_1080988913300021479SoilFSTFCRIVYAPPYGYSAVKFNVNLDGTMFYPCPKGT
Ga0126371_1195783933300021560Tropical Forest SoilFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0126371_1226087123300021560Tropical Forest SoilPCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0126371_1299916413300021560Tropical Forest SoilFAAFCRAVYAGPLGFSAVKFDVNLDGKVFFPCPRGR
Ga0126371_1342173433300021560Tropical Forest SoilGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPAGT
Ga0213851_144883313300021860WatershedsGQSCPPKRRFATFCRVVYAPPYGFSAVKFDVNLDGKMFYPCPRGT
Ga0207707_1077663413300025912Corn RhizosphereGRTFRAYCRRIYDGKNGFAAVKFDVNLDGRTFYPCPRGI
Ga0207693_1023642813300025915Corn, Switchgrass And Miscanthus RhizosphereFATFCRLVWGAPGGFSAVKFDVNLNGKVFYPCPRGA
Ga0207664_1095191513300025929Agricultural SoilCPRKRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT
Ga0207665_10000276363300025939Corn, Switchgrass And Miscanthus RhizosphereNPGQSCPPKRRYATFCRIVYAPPYGFAAVKFDVDLNGKMFYPCPRGT
Ga0209006_1085176713300027908Forest SoilLPPPKRRFATFCRVVYAPPDGFSAVKFDVDLNGKMFYPCPRGT
Ga0307281_1040483213300028803SoilVCSHKKSFATYCNVIYGQSYGFAGVKFDVNLDGKTFFPCPSGT
Ga0268241_1019657813300030511SoilKRTFKAFCQAVYAPANGFAAVKFDVNLDGKLFYPCPRGS
Ga0170818_10843148133300031474Forest SoilGKPCKPGRSFAAYCRRIYGGKNGFAAVKFDVNLDGRVFYPCPRGR
Ga0318534_1062565123300031544SoilADHYVCNPGQPCPAKRRFATFCRVVYAPSSGFSAVKFDVNLNGKIFYPCPRGT
Ga0318538_1020109013300031546SoilHYVCDPGQPCPAKRRFATFCRLVYAPSYGFTAVKFDVNLDGKIFYPCPRGT
Ga0318538_1045814433300031546SoilATFCRLVWRPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0318571_1018001213300031549SoilGQPCPPKRRFATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS
Ga0310915_1001366613300031573SoilFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318574_1080464923300031680SoilCNPGQPCPPKRRFATFCRVVYASPGGFSAVKFDVDLNGKMFYPCPRGT
Ga0318496_1004977163300031713SoilADHYVCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0318496_1067713113300031713SoilDHYVCDPGQPCPAKRRFATFCRLVYAPSYGFTAVKFDVNLDGRIFYPCPRGT
Ga0318493_1008334013300031723SoilCQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318501_1044344413300031736SoilQGKRRFATFCRLVWKAPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0306918_1015999313300031744SoilRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318492_1078090713300031748SoilADHYVCNPGQPCPGKRRFSTFCRVVYAPSYGFTAVKFDVNLDGRTFYPCPHGT
Ga0318494_1043917913300031751SoilGQQCQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318526_1004667413300031769SoilRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318552_1033118413300031782SoilKRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT
Ga0318548_1011215913300031793SoilGADGYVCNPGQPCQGKRSFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0318503_1007523433300031794SoilTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA
Ga0318576_1047522523300031796SoilPKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA
Ga0318576_1053921313300031796SoilFATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS
Ga0318550_1021362913300031797SoilHYVCNPGQPCRGRRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318565_1016824933300031799SoilCRGRRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318567_1005274713300031821SoilVCNPGQQCRGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0318499_1018724713300031832SoilGQPCQGKRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318517_1006330413300031835SoilGADHYVCNPGQPCTGKRRFVTFCRLVWGPPGGFSAVKFDVNLDGTVFYPCPRGT
Ga0306925_1123329033300031890SoilGKRRFATFCRLVWGAPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0318551_1067859413300031896SoilADGYVCNPGQQCRGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0310909_1068133923300031947SoilTCPPKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA
Ga0310909_1134366213300031947SoilGADHYVCNPGQQCPGKRSFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0306926_1174182333300031954SoilNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0310911_1009344943300032035SoilGKRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0310911_1057683723300032035SoilYGADGYVCNPGQQCQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318575_1027941413300032055SoilEDAYVCNPGQPCPGSRSFGAFCRSVYAVPHGFAAVKFDVNLDGRMFDPCP
Ga0318575_1028157133300032055SoilATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318533_1082079823300032059SoilCDPGKTCPPKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA
Ga0318510_1033737713300032064SoilCNPGQPCTGKRRFVTFCRLVWGPPGGFSAVKFDVNLDGTVFYPCPRGT
Ga0318513_1067341313300032065SoilPGKRRFSTFCRVVYAPSYGFTAVKFDVNLDGRTFYPCPHGT
Ga0318514_1010506013300032066SoilGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318553_1024634813300032068SoilEYGADHYVCNPGQPCQGKRRFATFCRLVWKAPGGFSAVKFDVNLDGKVFYPCPRGT
Ga0318553_1034866123300032068SoilYGADHYVCNPGQPCPRKRRFTTFCRVVYAPPYGFAAVKFDVNLDGKTFYPCPHGT
Ga0318553_1039010613300032068SoilRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0306924_1256641723300032076SoilPGQPCPPKRRFATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS
Ga0318577_1026317413300032091SoilRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA
Ga0318577_1028850933300032091SoilSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT
Ga0318577_1042773213300032091SoilVCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT
Ga0307470_1072717823300032174Hardwood Forest SoilSFAAFCRNVYSPAWGFAAVKFDVNLDGRMFYPCPSGI
Ga0306920_10306177413300032261SoilNPGQPCPRKRRFTTFCRVVYAPPYGFAAVKFDVNLDGKTFYPCPHGT
Ga0306920_10326636123300032261SoilCPAKRRFATFCRVVYAPSSGFSAVKFDVNLNGKIFYPCPRGT
Ga0318519_1094321623300033290SoilAYVCNPGQPCPGSRSFGAFCRSVYAVPHGFAAVKFDVNLDGRMFDPCP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.