| Basic Information | |
|---|---|
| Family ID | F077266 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VKGEEFKDDFRRALPKEVVHALTRRSAWRATAAVLHDFAVLA |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.76 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.02 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.231 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.256 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.026 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.590 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00171 | Aldedh | 82.05 |
| PF03401 | TctC | 13.68 |
| PF07995 | GSDH | 0.85 |
| PF01970 | TctA | 0.85 |
| PF00006 | ATP-synt_ab | 0.85 |
| PF01799 | Fer2_2 | 0.85 |
| PF02738 | MoCoBD_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 82.05 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 82.05 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 82.05 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 13.68 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.85 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.23 % |
| All Organisms | root | All Organisms | 30.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021057 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10220J13317_104015772 | 3300001139 | Soil | LRGEEFKDDFRKALPKELVQQLTRRSPWKATAAVLHDFAVLAAAIA |
| C688J18823_103684651 | 3300001686 | Soil | VSGEEFKDDYRRALPQALIQELTRRSAWPASAAVLADV |
| JGI24742J22300_100357652 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | VKGEEFKDDFRKALPKNVVQALTHRSPWPATAAVVHDVAVIAAAIAAAL |
| Ga0066677_104451181 | 3300005171 | Soil | VTGEEFKDDYRRALPKALIQELTRRSAWRASAAILADVAVLA |
| Ga0065707_103812781 | 3300005295 | Switchgrass Rhizosphere | MKGEEFKDDFRKALPRELVQELTRRSTWRATAAVASDFGILAL |
| Ga0070688_1002617051 | 3300005365 | Switchgrass Rhizosphere | MKGEEFKDDFRKALPRELVQELTRRSDWRATLAVFHDVLTLAA |
| Ga0070703_101322512 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VKGEEFKDDFRKALPKNVVQALTHRSPWPATAAVVHDVAVIAAAI |
| Ga0070694_1011292322 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VRGEEFKDDFRKALPREVVQRLTRRSAWRASAAVLHDFAVLAAAIWAGLYFW |
| Ga0073909_102140482 | 3300005526 | Surface Soil | MRGEEFKDDFRRALAPELVRELTRRSAWRATAAVLADIAVLALAIG |
| Ga0068853_1019556641 | 3300005539 | Corn Rhizosphere | VKGEDFKDDFRKALPKEVVQSLTRRSPWRATAAIVHDVAV |
| Ga0070695_1018979502 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGEEFKDDYRRALPKELIQALTRRSAWRASLAILHDLAVLA |
| Ga0066661_109259702 | 3300005554 | Soil | VTGEEFKDDYRRALPKELVRELTRRSAWRASAAVLEDFAVLAAAIALALAY |
| Ga0066699_103294941 | 3300005561 | Soil | MRGEEFKDDFRRALAPELVRELTRRSAWRASGAISADVAVLALA |
| Ga0066708_102476471 | 3300005576 | Soil | VTGEEFKDDYRRALPKELVQELTRRSAWRASAAVLADFAVLAAAIALALAY |
| Ga0068870_101201601 | 3300005840 | Miscanthus Rhizosphere | VKGEEFKDDFRKALPRELVQELTHRSAWRATLAVLSD |
| Ga0081539_103081582 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VGDEFKDDYRQALPREIIQRLTRRSAWRASLAIAHDF |
| Ga0074049_125790732 | 3300006580 | Soil | VRGEEFKDDFRRALPKEIVLELTQRSPWRATAAVLSDVF |
| Ga0066653_102212521 | 3300006791 | Soil | MSGEEFKDDHGRQGGRALPKTLVGELTRRSAWRASAAVLHDFAVLAGAIAIALV |
| Ga0075433_116584231 | 3300006852 | Populus Rhizosphere | MGEEFKDDYRQALPRELIQKLTRRNPWRATAAILHDLIVLAAA |
| Ga0075425_1001223654 | 3300006854 | Populus Rhizosphere | MGEEFKDDYRQALPRELIQKLTRRNPWRATAAILHDLIVLAAAIAAALWLW |
| Ga0079219_110253861 | 3300006954 | Agricultural Soil | VRGEEFKDDFRRALPKALVLELTRRSGWRASLAILSD |
| Ga0079219_117444901 | 3300006954 | Agricultural Soil | VASTSSLRGEEFKDDFRQALPKELVARLAQRSAWRATAAILEDFAVIAA |
| Ga0099791_100609141 | 3300007255 | Vadose Zone Soil | VSGEEFKDDYRRALPKELIQELTRRSAWRATAAVLAD |
| Ga0066710_1042635511 | 3300009012 | Grasslands Soil | VKGEEFKDDFRKALPKELVQALTRRSAWRASAAILH |
| Ga0111539_111862751 | 3300009094 | Populus Rhizosphere | VKGEEFKDDFRKALPRELVQELTLRSRWRASVAVLSDFVVLALAIWAGLYY |
| Ga0075418_129045791 | 3300009100 | Populus Rhizosphere | MKGEEFKDDFRKALPKEILAQLTRRSPWRASAAVLHDVVVLALAVSAGLYFW |
| Ga0114129_111094551 | 3300009147 | Populus Rhizosphere | VKGEEFKDDFRKALPREVVQALTHRSPWRASAAVLHDVAVIAV |
| Ga0114129_130969021 | 3300009147 | Populus Rhizosphere | VKGEEFKDDYRRALPKELVQELTRRSPWRATAAVLEDL |
| Ga0105243_109426162 | 3300009148 | Miscanthus Rhizosphere | VKGEEFKDDFRRALPKALVLELTRRSAWRASLAVAEDFAVLALAIAAALYW |
| Ga0111538_124881612 | 3300009156 | Populus Rhizosphere | VKGEEFKDDFRKAASRPSLPRELVQELTRRSTWRASAALLHDLL |
| Ga0111538_129289721 | 3300009156 | Populus Rhizosphere | LEALAVHKGEEFKDDFRRALPRELVVELTRRSAWRATAAVLQDVAVIALAAAV |
| Ga0075423_109035911 | 3300009162 | Populus Rhizosphere | VKGEEFKDDFRKALPRDVVQALARRSSWKATAAILHDVAVIAVALAVAL |
| Ga0105101_102794982 | 3300009171 | Freshwater Sediment | VKGEEFKDDFRRALPREVVQQLTRRSAWRATAAVVHDFAVIAAAI |
| Ga0105242_116981652 | 3300009176 | Miscanthus Rhizosphere | MKGEEFKDDWRGARKMPRELVQELTRRSAWRASIAVL |
| Ga0105340_11791521 | 3300009610 | Soil | VKGEEFKDDFRKALPREVVQRLTRRSPWRATFAVLHDVLILAAAIAVGLY |
| Ga0105340_12093352 | 3300009610 | Soil | MNGEEFKDDFRKALPKELVQRLTRRSAWRASAAIAQD |
| Ga0134067_102818481 | 3300010321 | Grasslands Soil | MSGEEFKDDYRRALPRELIQELTRRSAWRATAAVLEDF |
| Ga0134066_103736951 | 3300010364 | Grasslands Soil | MTGEEFKDDYRRALPRALVQQLTRRSAWRATRAVLS |
| Ga0134125_125295361 | 3300010371 | Terrestrial Soil | VGDEFKDDYRKALPKELVQELTRRSAWRAALAIAHDLAVI |
| Ga0134127_116646182 | 3300010399 | Terrestrial Soil | VKGEEFKDDFRKALPREVIQQLTRRSRWRATAAVLHDFLVLSAAIGIALY |
| Ga0134122_119054431 | 3300010400 | Terrestrial Soil | VVRGEEFKDDYRRALAPELVRELTRRSAARATAAVLADLAVLALAIG |
| Ga0105246_107671802 | 3300011119 | Miscanthus Rhizosphere | VKGEEFKDDFRKALPRELVQELTRRSTWRASFAVLSDFVVLA |
| Ga0137391_104735491 | 3300011270 | Vadose Zone Soil | VTGEEFKDDYRRALPKELVRELTRRSAWRASAAVLEDFAVLAAAIAL |
| Ga0127502_112973351 | 3300011333 | Soil | MKGEEFKDDFRKSLPRELVQELTRRSAWRASMAVVHDLAILAV |
| Ga0137452_10070091 | 3300011441 | Soil | VSAGEEFKDDFRKALPRELVLELTRRSAWRATAAVLSDVAVIALA |
| Ga0137457_13050512 | 3300011443 | Soil | VKGEESKDDFRKALPREVVQRLTRRSPWRATLSALHDFLILAAAIAVGL |
| Ga0137427_100670121 | 3300011445 | Soil | VSAGEEFKDDFRKALPRELVLELTRRSAWRATAAVLSDVA |
| Ga0137461_10115811 | 3300012040 | Soil | VTGEEFKDDFRKQLPKEVVVRLTQRSAWRASAAIAHDLAIIVASVGLAL |
| Ga0137330_10411581 | 3300012134 | Soil | VKGEEFKDDYRKALPREVVQRLTRRSPWRATLSVLHDV |
| Ga0137388_107980632 | 3300012189 | Vadose Zone Soil | VNQGEEFKDDFRKALPREIVLRLARRSPWRASAAI |
| Ga0137379_104405541 | 3300012209 | Vadose Zone Soil | VNKGEEFKDDFRKALPREIVLRLARRSAWRASAAMLHDLVVLATAIGV |
| Ga0137377_100976854 | 3300012211 | Vadose Zone Soil | VSEPARGEEFKDDFRKALPKELVQRLTRRSAWRAT |
| Ga0137447_10504792 | 3300012226 | Soil | MRGHEVSAGEEFKDDFRKALPRELVLELTRRSAWRATAAVLSDVAVIALAAAVA |
| Ga0137370_108165982 | 3300012285 | Vadose Zone Soil | MRGEEFKDDFRKALPKELVQSLTRRSAWRASAAVLHDFAVIAIALAAALYFW |
| Ga0137369_111568192 | 3300012355 | Vadose Zone Soil | VNKGEEFKADFRKALPRDIVLRLARRSAWRASAAIV |
| Ga0157313_10677962 | 3300012503 | Arabidopsis Rhizosphere | VKGEEFKDDFRQALPKEIVRELTRRNAWRATAAMAHDFAVSALAIAAGL |
| Ga0137419_114525141 | 3300012925 | Vadose Zone Soil | VTGEEFKDDFRKALPKELVQRLTRRSAWLATLAVL |
| Ga0164300_111806272 | 3300012951 | Soil | VKGEEFKDDHRSASGRADSSRALPKALVLELTRRSAWRATLAVLEDLAVLALAIGA |
| Ga0164303_112383981 | 3300012957 | Soil | VGGEEFKDDFRRALPKEVVRELTRRSAWRATAAVLADVAV |
| Ga0126369_133910791 | 3300012971 | Tropical Forest Soil | VKGEEFKDDFRKALPKELVQRLTQRSSLRATAAILQDVVVI |
| Ga0157374_115020661 | 3300013296 | Miscanthus Rhizosphere | VKGEDFKDDFRKALPKEVVQSLTRRSPWRATAAIVHDVAVIAA |
| Ga0157374_128392712 | 3300013296 | Miscanthus Rhizosphere | VKGEEFKDDHRSANGRANSSRALPKALVLELTRRSAWRATLAVLEDFAVLALAIAAALPW |
| Ga0157378_115026301 | 3300013297 | Miscanthus Rhizosphere | VGDQFKDDYRKALPQDLVRQLTQRSAWRATAAIFHD |
| Ga0157375_104200091 | 3300013308 | Miscanthus Rhizosphere | MKGEEFKDDFRKAASRPSLPRELVQELTRRSRWRATAAVASD |
| Ga0075302_11736062 | 3300014269 | Natural And Restored Wetlands | VGEEFKDDFRQALPKDLVLRLTRRNPWRAGAAIVHDLAV |
| Ga0180088_10826402 | 3300014868 | Soil | VKGEEFKDDFRKALPKEVVARLTRRSPWRATAAVLHDVVVLALAISAG |
| Ga0137411_12837461 | 3300015052 | Vadose Zone Soil | MTGEEFKDDYRRALPKELIRELTRRSAWRATAAVLEDFAVL |
| Ga0137420_11990531 | 3300015054 | Vadose Zone Soil | VSEPARGEEFKDDYRKALPLELVQRLARRCSAWRSSAALLQDMFVLIVSIS |
| Ga0137420_12473872 | 3300015054 | Vadose Zone Soil | VSEPARGEEFKDDYRKALPLELVQRLARRSAWRSSAALLQDMFVLIVSISV |
| Ga0180067_10650602 | 3300015257 | Soil | VKGEEFKDDVRKGLPKEIVARLTRRSPWRATLAVLHDVSVIAAAIAAG |
| Ga0132258_124344761 | 3300015371 | Arabidopsis Rhizosphere | MTGEEFKDDYRRALPKELIRELTRRSAWRATAAVL |
| Ga0132257_1033068952 | 3300015373 | Arabidopsis Rhizosphere | VKGEDFKDDFRKALPKALVQSLTRRSPWRATAAILHDVAVIAIAIAVALHF |
| Ga0190265_133907241 | 3300018422 | Soil | VKGEEFKDDWRGARKLPLELLQELTRRSPWRATLAVLHDFLILAAAIAV |
| Ga0190272_101254321 | 3300018429 | Soil | VKGEDCKDDFRRALPKEVVHLLTRRSAWHATAAVLHDFAVIAIAVAVAL |
| Ga0190274_115893542 | 3300018476 | Soil | VHKGEEFKDDFRKALPRELVLELTRRSAWRAIAAVLQDVTVIA |
| Ga0190264_117529132 | 3300019377 | Soil | VHKGEEFKDDFRKAASRPALPRELVLELTRRSPWRATAAVLQDVAVIA |
| Ga0196981_10301432 | 3300021057 | Soil | VNRGEEFKDDFRKALPREIVQALTRRSAWRASLAVLEDVLVLGVALAIGI |
| Ga0247676_10198881 | 3300024249 | Soil | MTGEEFKDDFRRALPKELIEQLTRRSAWRATLAVLSDFLVLAAAIALALAY |
| Ga0209321_102480192 | 3300025312 | Soil | VTGEEFKDDFRKQLPKEAVLRLTQRSPWRASAAIAHDLAIIGASIGLAL |
| Ga0207653_101226851 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGEEFKDDFRKALPRELVQELTRRSAWRATLCVLEDLAVLA |
| Ga0207645_109851401 | 3300025907 | Miscanthus Rhizosphere | VKGEEFKDDFRKALPRELVQELTRRSTWRASFAVLSD |
| Ga0207660_106576412 | 3300025917 | Corn Rhizosphere | VTGEEFKDDFRKALPKEVVYRLTRRSAWRASAAVLQDLVVLAAAIWAALYF |
| Ga0207662_113289061 | 3300025918 | Switchgrass Rhizosphere | VKGEEFKDDYRRALPKALVLELTRRSAWRASRAVLEDLAVLALAVGAAL |
| Ga0210089_10081831 | 3300025957 | Natural And Restored Wetlands | VGEEFKDDFRQALPKELVQQLTRRNAWRASAAIAHDLAVLAAAIGAALY |
| Ga0207668_103479542 | 3300025972 | Switchgrass Rhizosphere | MKGEEFKDDFRKALPRELVQELTRRSTWRATAAVASDFG |
| Ga0209803_10683261 | 3300026332 | Soil | VSEPVQGEEFKDDFRKALPKELVRRLTRRSAWRSSAALLQDIFVLIVSVS |
| Ga0209808_10820122 | 3300026523 | Soil | VTQIQRGEEFKDDFRKELPREIVLRLARRSAWRASAAILHDLIVIAIS |
| Ga0209805_11629422 | 3300026542 | Soil | VSQPVHGEEFKDDYRKALPKQLVQRLARRSAWRASAAVAQDVLVL |
| Ga0209577_102177321 | 3300026552 | Soil | MRGEEFKDDFRRALAPALVRELTRRSAWRASAAIFADVAVLALA |
| Ga0208525_10168532 | 3300027288 | Soil | VRGEEFKDDFRKALPKEVVQSLTRRSPWRATAAFLHDVAVIAAAIAV |
| Ga0209213_10272332 | 3300027383 | Forest Soil | VSEPARGEEFKDDYRKALPKQLVQRLASRSAWRASAAVLQDVLVL |
| Ga0209874_10398821 | 3300027577 | Groundwater Sand | VRGEEFKDDFRKALPKEVVQSLTRRSAWRASAAVLHDFAVIAIALA |
| Ga0209703_10067124 | 3300027723 | Freshwater Sediment | MRSGEEFKDDFRKALPRELVLELTRRSPWRATAAVLA |
| Ga0209590_107577832 | 3300027882 | Vadose Zone Soil | VSEPVHGEEFKDDYRKALPKELVQRLARRSAWRASAAVLQDVVVL |
| Ga0209486_103010942 | 3300027886 | Agricultural Soil | VKGEEFKDDFRRALPKEVVHALTRRSAWRATAAVLHDFAVLA |
| Ga0209486_111170811 | 3300027886 | Agricultural Soil | VKGEEFKDDFRKASLPRELVLELTRRSPWRATAAVVHDFAVLAFAV |
| Ga0209382_102974673 | 3300027909 | Populus Rhizosphere | VKGEEFKDDFRKALPREFVQALTHRSPWRASAAVLHDVAVIAVAL |
| Ga0209382_108020551 | 3300027909 | Populus Rhizosphere | VKGEEFKDDFRKALPKEVVQSLTRRSAWRASAAILHD |
| Ga0209583_105659101 | 3300027910 | Watersheds | MTGEEFKDDFRKALPKELLQRLTRRSAWRASAAIFEDLAVIFFSI |
| Ga0307503_100231183 | 3300028802 | Soil | MSVGEEFKDDFRKALPRELVLELTRRSTWRASLAVFQD |
| Ga0307503_105347272 | 3300028802 | Soil | VRGEEFKDDFRKALPKELVLELTRRSAWRATLPIVADFA |
| Ga0247825_100192091 | 3300028812 | Soil | VKGEEFKDDFRKALPRELVQALTRRSPGKASVAILHDAAVIAAAVAVAL |
| Ga0307302_102175001 | 3300028814 | Soil | VKGEEFKDDFRRALPKELVQVLTRRSAWRASAAILHDVAVIAAALAIALHF |
| Ga0307495_102566871 | 3300031199 | Soil | MAFVGDEFKDDYRKALPKDLVQQLTRRSAWRATAAIFHDI |
| Ga0307506_103102451 | 3300031366 | Soil | LKGEEFKDDFRKALPKEVVLELTRRSAWRASVAVL |
| Ga0307469_123557521 | 3300031720 | Hardwood Forest Soil | VGEEFKDDFRQALPKDLVQRLTHRDGWRATATLVHDFAVLALAIF |
| Ga0307405_119790551 | 3300031731 | Rhizosphere | MKGEEFKDDFRKALPRELVQELARRSAWRATLAVLGDLAV |
| Ga0307468_1023107781 | 3300031740 | Hardwood Forest Soil | MTGEEFKDDYRRALPKELVQQLTRRSAWRATLAVAEDFAVLAIAIGIAL |
| Ga0310885_107188502 | 3300031943 | Soil | MKGEEFKDDFRKALPRELVQELTRRSTWRATAAVAS |
| Ga0307416_1008827391 | 3300032002 | Rhizosphere | VKGEEFKDDFRKALPREVIQQLTRRSPWRATAAVLHDFLILA |
| Ga0307416_1019021451 | 3300032002 | Rhizosphere | VKGEEFKDDFRKALPRDVVLALTRRSAWRASAAVLQDFAVIALAVAAAL |
| Ga0310896_106590011 | 3300032211 | Soil | VKGEEFKDDYRRALPKALVLELTRRSAWRASRAVLEDLAVLAL |
| Ga0335070_108226572 | 3300032829 | Soil | LKGEDFKDDFRKALPKELVQELTRRSAWRSTLAVLEDVAVLAASIA |
| Ga0214472_115681722 | 3300033407 | Soil | VKGEEFKDDFREALPRDVVERLRRRSASRATAAVLHDFAVLAAAIWIAL |
| Ga0364929_0050772_1116_1256 | 3300034149 | Sediment | VKGEEFKDDFRKALPKEVVQALTRRSPWKASAAVLHDVAVIAAAIAV |
| Ga0372943_0841487_500_607 | 3300034268 | Soil | MKGEEFKDDFRQSLPKELIQRLTQRSAWRATLAVLE |
| Ga0314793_120108_433_567 | 3300034668 | Soil | MKGEEFKDDFRKALPKTLVLELTRRSAWRATLAIAEDFVVLALAI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |