Basic Information | |
---|---|
Family ID | F076919 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 49 residues |
Representative Sequence | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRRTPAKA |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.60 % |
% of genes near scaffold ends (potentially truncated) | 16.24 % |
% of genes from short scaffolds (< 2000 bps) | 76.07 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.872 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (49.573 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.154 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.991 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00873 | ACR_tran | 12.82 |
PF16576 | HlyD_D23 | 4.27 |
PF16701 | Ad_Cy_reg | 4.27 |
PF00702 | Hydrolase | 3.42 |
PF09851 | SHOCT | 3.42 |
PF03243 | MerB | 1.71 |
PF02321 | OEP | 1.71 |
PF09594 | GT87 | 1.71 |
PF01545 | Cation_efflux | 1.71 |
PF13411 | MerR_1 | 1.71 |
PF08282 | Hydrolase_3 | 1.71 |
PF13115 | YtkA | 0.85 |
PF01243 | Putative_PNPOx | 0.85 |
PF13545 | HTH_Crp_2 | 0.85 |
PF07592 | DDE_Tnp_ISAZ013 | 0.85 |
PF13683 | rve_3 | 0.85 |
PF07813 | LTXXQ | 0.85 |
PF13378 | MR_MLE_C | 0.85 |
PF00381 | PTS-HPr | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 3.42 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.42 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.71 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.71 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.71 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.71 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.71 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.71 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.71 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.71 |
COG1925 | HPr or related phosphotransfer protein | Signal transduction mechanisms [T] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.87 % |
Unclassified | root | N/A | 5.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_100891252 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300000956|JGI10216J12902_106613989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin122 | 2161 | Open in IMG/M |
3300002561|JGI25384J37096_10049127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1608 | Open in IMG/M |
3300002908|JGI25382J43887_10489653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
3300002914|JGI25617J43924_10121129 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300005167|Ga0066672_10034073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2811 | Open in IMG/M |
3300005171|Ga0066677_10409622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
3300005174|Ga0066680_10088214 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1880 | Open in IMG/M |
3300005174|Ga0066680_10250083 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300005176|Ga0066679_10327995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 999 | Open in IMG/M |
3300005178|Ga0066688_10810490 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300005180|Ga0066685_10193363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1394 | Open in IMG/M |
3300005187|Ga0066675_10141044 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300005447|Ga0066689_10987229 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005468|Ga0070707_100181258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2053 | Open in IMG/M |
3300005540|Ga0066697_10005160 | All Organisms → cellular organisms → Bacteria | 6320 | Open in IMG/M |
3300005559|Ga0066700_10056311 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
3300005559|Ga0066700_10138054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1639 | Open in IMG/M |
3300005586|Ga0066691_10373717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 845 | Open in IMG/M |
3300005598|Ga0066706_10628586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 852 | Open in IMG/M |
3300006032|Ga0066696_10361870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 946 | Open in IMG/M |
3300006034|Ga0066656_10083334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1913 | Open in IMG/M |
3300007255|Ga0099791_10036493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2173 | Open in IMG/M |
3300007255|Ga0099791_10052888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1821 | Open in IMG/M |
3300007255|Ga0099791_10097626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1350 | Open in IMG/M |
3300007265|Ga0099794_10026122 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
3300009012|Ga0066710_104163502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300009038|Ga0099829_10008812 | All Organisms → cellular organisms → Bacteria | 6417 | Open in IMG/M |
3300009038|Ga0099829_10826093 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009088|Ga0099830_10172015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_68_14 | 1680 | Open in IMG/M |
3300009088|Ga0099830_10382720 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300009088|Ga0099830_11290882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300009089|Ga0099828_10005770 | All Organisms → cellular organisms → Bacteria | 8887 | Open in IMG/M |
3300009143|Ga0099792_10396015 | Not Available | 844 | Open in IMG/M |
3300010304|Ga0134088_10006946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4767 | Open in IMG/M |
3300010304|Ga0134088_10701619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
3300010336|Ga0134071_10145940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1148 | Open in IMG/M |
3300010376|Ga0126381_104348433 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012202|Ga0137363_10079113 | All Organisms → cellular organisms → Bacteria | 2444 | Open in IMG/M |
3300012203|Ga0137399_10187037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1675 | Open in IMG/M |
3300012203|Ga0137399_11166902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 648 | Open in IMG/M |
3300012205|Ga0137362_10093933 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2517 | Open in IMG/M |
3300012205|Ga0137362_10507117 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1043 | Open in IMG/M |
3300012205|Ga0137362_10739492 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300012205|Ga0137362_10796100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 810 | Open in IMG/M |
3300012357|Ga0137384_10430752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1087 | Open in IMG/M |
3300012361|Ga0137360_10115351 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2080 | Open in IMG/M |
3300012361|Ga0137360_10348780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1239 | Open in IMG/M |
3300012361|Ga0137360_11806949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300012362|Ga0137361_10084562 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
3300012362|Ga0137361_10195937 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
3300012362|Ga0137361_11043546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
3300012362|Ga0137361_11478333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 143 | 602 | Open in IMG/M |
3300012373|Ga0134042_1111233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1147 | Open in IMG/M |
3300012380|Ga0134047_1038419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
3300012393|Ga0134052_1172590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
3300012582|Ga0137358_10045472 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
3300012582|Ga0137358_10096761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1997 | Open in IMG/M |
3300012582|Ga0137358_10627999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 720 | Open in IMG/M |
3300012918|Ga0137396_10108644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1988 | Open in IMG/M |
3300012918|Ga0137396_10114490 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300012922|Ga0137394_10004991 | All Organisms → cellular organisms → Bacteria | 10090 | Open in IMG/M |
3300012922|Ga0137394_10329770 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1303 | Open in IMG/M |
3300012922|Ga0137394_10493590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1040 | Open in IMG/M |
3300012922|Ga0137394_11312540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
3300012923|Ga0137359_10330768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1355 | Open in IMG/M |
3300012925|Ga0137419_10898059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
3300012927|Ga0137416_11271054 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012927|Ga0137416_11825754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300012929|Ga0137404_10059187 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
3300012929|Ga0137404_10060604 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
3300012929|Ga0137404_10918639 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 799 | Open in IMG/M |
3300012930|Ga0137407_10046262 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3507 | Open in IMG/M |
3300012944|Ga0137410_10049370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2993 | Open in IMG/M |
3300012975|Ga0134110_10385504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
3300012976|Ga0134076_10063888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300012976|Ga0134076_10192525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 852 | Open in IMG/M |
3300015053|Ga0137405_1315513 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300015245|Ga0137409_10363793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1259 | Open in IMG/M |
3300015245|Ga0137409_11572067 | Not Available | 508 | Open in IMG/M |
3300015264|Ga0137403_10093402 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300015358|Ga0134089_10015941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2500 | Open in IMG/M |
3300017656|Ga0134112_10043506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1612 | Open in IMG/M |
3300017997|Ga0184610_1036563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1402 | Open in IMG/M |
3300017997|Ga0184610_1289113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300018031|Ga0184634_10036450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1975 | Open in IMG/M |
3300018053|Ga0184626_10290262 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
3300018056|Ga0184623_10036196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2234 | Open in IMG/M |
3300018075|Ga0184632_10240738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
3300018075|Ga0184632_10291235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 708 | Open in IMG/M |
3300018431|Ga0066655_10103668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1599 | Open in IMG/M |
3300018431|Ga0066655_11026002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
3300018482|Ga0066669_11041017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 739 | Open in IMG/M |
3300020170|Ga0179594_10033587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1653 | Open in IMG/M |
3300020170|Ga0179594_10084611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1123 | Open in IMG/M |
3300020199|Ga0179592_10132863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1142 | Open in IMG/M |
3300025910|Ga0207684_10008169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9322 | Open in IMG/M |
3300025910|Ga0207684_10200343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1722 | Open in IMG/M |
3300025922|Ga0207646_11907037 | Not Available | 506 | Open in IMG/M |
3300026298|Ga0209236_1230653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300026304|Ga0209240_1062988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1386 | Open in IMG/M |
3300026324|Ga0209470_1221278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
3300026325|Ga0209152_10009790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3347 | Open in IMG/M |
3300026331|Ga0209267_1158505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
3300026334|Ga0209377_1166285 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 809 | Open in IMG/M |
3300026514|Ga0257168_1011531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1696 | Open in IMG/M |
3300026514|Ga0257168_1083376 | Not Available | 709 | Open in IMG/M |
3300026532|Ga0209160_1103316 | Not Available | 1439 | Open in IMG/M |
3300026536|Ga0209058_1135249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1192 | Open in IMG/M |
3300026550|Ga0209474_10130096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1659 | Open in IMG/M |
3300027655|Ga0209388_1205837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
3300027671|Ga0209588_1025453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1873 | Open in IMG/M |
3300027846|Ga0209180_10003935 | All Organisms → cellular organisms → Bacteria | 7433 | Open in IMG/M |
3300027875|Ga0209283_10004741 | All Organisms → cellular organisms → Bacteria | 7787 | Open in IMG/M |
3300027903|Ga0209488_10007061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8440 | Open in IMG/M |
3300027903|Ga0209488_10876224 | Not Available | 631 | Open in IMG/M |
3300028536|Ga0137415_11017950 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 49.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.40% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1008912522 | 3300000559 | Soil | MMQMMDMGCGPFMAIAVRLGWLLGLGLVGSLTVLVWVVIGRLRRTPGAV* |
JGI10216J12902_1066139891 | 3300000956 | Soil | MMQMMDMGCGPFMAIPGGLSWLLGLGLVGSLTVLVWVVIGRLRRTPGAV* |
JGI25384J37096_100491273 | 3300002561 | Grasslands Soil | MMHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
JGI25382J43887_104896531 | 3300002908 | Grasslands Soil | MMHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPV |
JGI25617J43924_101211292 | 3300002914 | Grasslands Soil | MMHMMDMSCGPLMAVVGGISWLLGLGLVGSLXVLVWVVIGRLRRTPVGA* |
Ga0066672_100340734 | 3300005167 | Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPAKA* |
Ga0066677_104096222 | 3300005171 | Soil | MMHMMNESCGPLMIALMGLGWLLGLGLVASLIVLVWTAVGRLKQTPAKA* |
Ga0066680_100882142 | 3300005174 | Soil | MLQMMNEACRPLMTAVMGLSWLLGLGLVVSLIVLVWTVVGRLRRTPAQS* |
Ga0066680_102500832 | 3300005174 | Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRRTPAEA* |
Ga0066679_103279952 | 3300005176 | Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVASLIVLVWTAVGRLKQTPAKA* |
Ga0066688_108104902 | 3300005178 | Soil | MHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0066685_101933633 | 3300005180 | Soil | MMQMMNETCGPLMMAVMGLSWLLGLGLVVSLIVLVWTAIGRLRRTPTQS* |
Ga0066675_101410444 | 3300005187 | Soil | MMQMMNESCGPLMIVLMGLGWLLGLGLVGSLIVLTWTVVGRLRRTSANA* |
Ga0066689_109872292 | 3300005447 | Soil | CGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRRTPAEA* |
Ga0070707_1001812582 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQMMNEACGPLMTAVMGLSWLLGLGLVVSLIVLVWTVVGRLRRTPAQS* |
Ga0066697_100051607 | 3300005540 | Soil | GPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPAKA* |
Ga0066700_100563115 | 3300005559 | Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVASLIVLVWTAVGRLRQTPAKA* |
Ga0066700_101380542 | 3300005559 | Soil | MMHMMDGACGPLMIVVMGLSWLLGLGLVASFIVLVWTAIVRLRRTPVRS* |
Ga0066691_103737172 | 3300005586 | Soil | MMQMMNETCGPLMMAVMGLSGLLGLGLVVSLIVLVWAAIGRLRRTPTQS* |
Ga0066706_106285862 | 3300005598 | Soil | MMHMMGGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0066696_103618703 | 3300006032 | Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRL |
Ga0066656_100833344 | 3300006034 | Soil | MMHMMNESCGPFMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPAKA* |
Ga0099791_100364932 | 3300007255 | Vadose Zone Soil | MMHMMDGACGPLMMVVMGLSWLLGLGLVASLIVLVWTAVGWLRRTPVRS* |
Ga0099791_100528883 | 3300007255 | Vadose Zone Soil | MMQMMNGSCGPFMMIVGGLSWLLGLGLVVSLMVLVWTAIGWLRRAPTPRQSAT* |
Ga0099791_100976262 | 3300007255 | Vadose Zone Soil | MMHMMNESCGPLMIALMGAGWLFGLGLIGSLIVLAWTAVGRLRRTPAKA* |
Ga0099794_100261224 | 3300007265 | Vadose Zone Soil | MVHMMNESCGPLMIALMGAGWLLGLGLIGSLIVLAWTAVGHLRRTPTKA* |
Ga0066710_1041635021 | 3300009012 | Grasslands Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLR |
Ga0099829_100088127 | 3300009038 | Vadose Zone Soil | MMHMMNETCGPLMMAVMGLSWLLGLALVVSLIVLVWAAIGRLRRPPTQS* |
Ga0099829_108260931 | 3300009038 | Vadose Zone Soil | MVEKEDQDMMHMMDMSCGPLMAVVGGISWLIGLGLVGSLTVLVWVVIGRLRRTPVGA* |
Ga0099830_101720154 | 3300009088 | Vadose Zone Soil | MMHMMNETCGPLMMAVMGLSWLLGLALVVSLIVLAWAAIGRLRRPPTQS* |
Ga0099830_103827201 | 3300009088 | Vadose Zone Soil | MMHMMDGSCGPLMALIMGLGGLLSLGLVGSLIVLVWVTIGYLRRRPA* |
Ga0099830_112908822 | 3300009088 | Vadose Zone Soil | MVEKEDQDMMHMMDMSCGPLMAVVGGITWLIGLGLVGSLTVLVWVVIGRLRRAPVAA* |
Ga0099828_100057703 | 3300009089 | Vadose Zone Soil | MMHMMNETCGPLMMAVMGLSWLFGLALVVSLIVLVWAAIGRLRRPPTQS* |
Ga0099792_103960152 | 3300009143 | Vadose Zone Soil | MVHMMNESCGPLMIALMGAGWLLGLGLIGSLIVLAWTAVGRLRRMPAKGS* |
Ga0134088_100069462 | 3300010304 | Grasslands Soil | MMHMVDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0134088_107016192 | 3300010304 | Grasslands Soil | CVPLMTAVMGLSWLLGLELVVSLIVLVWTVVVRLRRTPAES* |
Ga0134071_101459403 | 3300010336 | Grasslands Soil | MLQMMNEACGPLMTAVMGLSWLLGLGLVVSLIVLVWTAIGRLRRTPTQS* |
Ga0126381_1043484331 | 3300010376 | Tropical Forest Soil | MDMTCGPLMMALGGLGWLVGLGLVGSLIVLVWVVIGRLRHPQAIR* |
Ga0137363_100791132 | 3300012202 | Vadose Zone Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVASLIVLVWTAVGRLRRTPVKA* |
Ga0137399_101870373 | 3300012203 | Vadose Zone Soil | MMQMMNGSCGPFMMIVGGLSWLLGLGLVVSLIVLVWTAIGWLRRAPTPRQSAT* |
Ga0137399_111669021 | 3300012203 | Vadose Zone Soil | MVHMMNESCGSLMIALMGAGWLLGLGLIGSLIVLAWTAVGRLRRTPANA* |
Ga0137362_100939332 | 3300012205 | Vadose Zone Soil | MVHMMNESCGPLMIALMGAGWLLGLGLIGSLIVLAWTAVGRLRRMPAKA* |
Ga0137362_105071171 | 3300012205 | Vadose Zone Soil | MMQMMNGSCGPFMMIVGGLSWLLGLGLVVSLMVLVWTAIGWLRRAPTPRQ |
Ga0137362_107394923 | 3300012205 | Vadose Zone Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVGSLIVLTWTVVGRLRRTSANA* |
Ga0137362_107961002 | 3300012205 | Vadose Zone Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVASLIVLVWTAVGRLRQTPVKA* |
Ga0137384_104307521 | 3300012357 | Vadose Zone Soil | MMQMMNGGCGPFMMIVGGLSWLLGLGLVVSLIVLAWTAIGWLRRASTPRQSAT* |
Ga0137360_101153512 | 3300012361 | Vadose Zone Soil | MMHMMDGSCGPLMMIIGGLSWFLGLGLVVSLIVLVWTAIGWLRRASVPRQSAT* |
Ga0137360_103487802 | 3300012361 | Vadose Zone Soil | MMQMMNETCGPLMMAVMGLSWLLGLGLVVSLIVLVWAAIGRLRRTPTQS* |
Ga0137360_118069492 | 3300012361 | Vadose Zone Soil | MMQMMNESCGPLMMVLMGLGWLLGLGLVGSLIVLTWTVVGRLRRTPANA* |
Ga0137361_100845622 | 3300012362 | Vadose Zone Soil | MMHMMDGSCGPLMALIIGLGGLLSLGLVGSLIVLVWVTIGYLRRRPA* |
Ga0137361_101959374 | 3300012362 | Vadose Zone Soil | MVHMMNESCGPLMIALMGAGWLFGLGLIGSLIVLAWTAVGRLRRTPAKA* |
Ga0137361_110435461 | 3300012362 | Vadose Zone Soil | MMAGSCGPLMMIIGGVSWLFGLGLVVSLIVLVWTAIGWLRRASVPKQSAT* |
Ga0137361_114783332 | 3300012362 | Vadose Zone Soil | MMHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAVGRLRRPPAKV* |
Ga0134042_11112333 | 3300012373 | Grasslands Soil | MMHMMDGACGPLMMVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0134047_10384192 | 3300012380 | Grasslands Soil | MMHMIDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0134052_11725901 | 3300012393 | Grasslands Soil | MMHMVDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTVVGRLRRTPAQS* |
Ga0137358_100454724 | 3300012582 | Vadose Zone Soil | MMHMMGGSCGPFMTIIGGITWLFGLGLVGSLIALTWVAIGQLRRKAA* |
Ga0137358_100967613 | 3300012582 | Vadose Zone Soil | MMHMMDGSCGPLMMIIGGVSWLFGLGLVVSLIVLVWTAIGWLRRASVPKQSAT* |
Ga0137358_106279991 | 3300012582 | Vadose Zone Soil | MMHMMNESCGPLMIALMGAGWLFGLGLIGSLIVLAWTAVGRLRRTPAK |
Ga0137396_101086442 | 3300012918 | Vadose Zone Soil | MMHMMNENCGPLMIALMGVGWLLGLGLIGSLIVLAWTAVGHLRRTSANA* |
Ga0137396_101144902 | 3300012918 | Vadose Zone Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTVIGRLRQTPAKA* |
Ga0137394_100049918 | 3300012922 | Vadose Zone Soil | MMHMMDGNCGPLMMVLGGLTWLLGLGLVGSLIALVWVAIGRLRRTSA* |
Ga0137394_103297703 | 3300012922 | Vadose Zone Soil | MMPMMNESCGPLMTALMGLGWLLGLGLVGSLIVLVWTVVGRLRRPPATV* |
Ga0137394_104935901 | 3300012922 | Vadose Zone Soil | MMHMMSENCGPLMMAMMGVGWLLGLGLVGSLIVLVWT |
Ga0137394_113125402 | 3300012922 | Vadose Zone Soil | MMQMMNESCGSLMIALMGAGWLLGLGLVGSLIVLAWTAVGRLRRTPAKA* |
Ga0137359_103307682 | 3300012923 | Vadose Zone Soil | MMHMMDGSCGPLMMIIGGLSWFLGLGLVVSLIVLVWTAIGWLRRASVPKQSAT* |
Ga0137419_108980591 | 3300012925 | Vadose Zone Soil | MVHMMNESCGSLMIALMGAGWLLGLGLIGSLIVLAWTAVGRLRRTPAKA* |
Ga0137416_112710542 | 3300012927 | Vadose Zone Soil | MVEKEDQDMMHMIDMSCGPLMAVVGGISWLIGLGLVGSLTVLVWVVIGRLRRTPVGA* |
Ga0137416_118257541 | 3300012927 | Vadose Zone Soil | MMHMMNESCGRLMITLMGAGWLLGLGLIGSLIVLAWTAVGRLRRTPAKA* |
Ga0137404_100591874 | 3300012929 | Vadose Zone Soil | MMHMMDGNCGPLMMVLGGLTWLLGLGLVGSLIALVWVAIWRLRKTSA* |
Ga0137404_100606042 | 3300012929 | Vadose Zone Soil | MMQMMDMNCGPFMMVIMGLGTLLSLGLVGSLIVLVWVVIGRLRRAPAAP* |
Ga0137404_109186392 | 3300012929 | Vadose Zone Soil | MQMMNETCGPLMMAVMGLSWLLGLGLVVSLIVLVWAAIGRLRRTPTQS* |
Ga0137407_100462622 | 3300012930 | Vadose Zone Soil | MMHMMNESCGPLMIALMGASWLLGLGLVASLIVLVWTAVGRLRRPPAKV* |
Ga0137410_100493701 | 3300012944 | Vadose Zone Soil | MMYLMNESCGPLMIALMGLAWLLGLGLVGSLIVLAWTAVGRLRRTPAKA* |
Ga0134110_103855042 | 3300012975 | Grasslands Soil | MMHMMNESCRPFMIALMGVGWLLGLGLVGSLIVLVWTVIGRLRRTPAKA* |
Ga0134076_100638881 | 3300012976 | Grasslands Soil | MMQMMNETCGPLMMAVMGLSWLLGLGLVVSLIVLVWTVVGRLRRTPAQS* |
Ga0134076_101925251 | 3300012976 | Grasslands Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRRTPAKA* |
Ga0137405_13155133 | 3300015053 | Vadose Zone Soil | MMHMMNEKLWTAHDRSHGASWLLGLGLVASLIVLVWTAVGRLRQAAG* |
Ga0137409_103637933 | 3300015245 | Vadose Zone Soil | MHMMNESCGPLMTAMMGLGWLLGLGLVGSLIVLVWTAVGRLRRTPTQA* |
Ga0137409_115720671 | 3300015245 | Vadose Zone Soil | SGLPSIRPAEKEDTEMMHMMNESCGPLMIALMGAGWLLGLGLVASLIVLVWTAVGRLRRTPPAKA* |
Ga0137403_100934025 | 3300015264 | Vadose Zone Soil | MMHMMDGNCGPLMMVLGGLTWLLGLGLVGSLIALVWVAIGRLRKTSA* |
Ga0134089_100159413 | 3300015358 | Grasslands Soil | MHMVDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS* |
Ga0134112_100435062 | 3300017656 | Grasslands Soil | MMHMVDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS |
Ga0184610_10365632 | 3300017997 | Groundwater Sediment | MMQMMDMSCGLLMTVLGGIGWLIGLGLVGSLTVLVWVVIGRLRRTPVAA |
Ga0184610_12891132 | 3300017997 | Groundwater Sediment | MMHMMNESCGPLMTVMMGLGWLLGLGLVGSVIVLVWAAIGRLRRTPAQV |
Ga0184634_100364503 | 3300018031 | Groundwater Sediment | MMHMMTESCGPLMTAMMGLGWLLGLGLVASLIVLVWTVVGRLRRTPTQA |
Ga0184626_102902621 | 3300018053 | Groundwater Sediment | MIHMMNESCGPLMTVMMGLGWLLGLGLVGSLIVLVWAAIGRLRRTPTQV |
Ga0184623_100361962 | 3300018056 | Groundwater Sediment | MMQMMDMSCGPLMAVLGGISWLIGLGLVGSLTVLVWVVIGRLRRTPVAA |
Ga0184632_102407381 | 3300018075 | Groundwater Sediment | AEKEDREMMHMMNESCGPLMTAIMGLGWLLGLGLVGSLIVLVWAAVGRLRRPPARA |
Ga0184632_102912352 | 3300018075 | Groundwater Sediment | MMHMMTESCGPLMTAMMGLGWLLGLGLVGSLIVLVWTVVGRLRRTPTQA |
Ga0066655_101036682 | 3300018431 | Grasslands Soil | MMHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS |
Ga0066655_110260022 | 3300018431 | Grasslands Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPAKA |
Ga0066669_110410172 | 3300018482 | Grasslands Soil | MMHMMNESCGPLMIALMGLGWLLGLGLVASLIVLVWTAVGRLKQTPAKA |
Ga0179594_100335872 | 3300020170 | Vadose Zone Soil | MMHMMNESCGPLMIALMGASWLLGLGLVASLIVLVWTAVGRLRRPPAKV |
Ga0179594_100846112 | 3300020170 | Vadose Zone Soil | MMHMMDGSCGPLMMIIGGLSWFLGLGLVVSLIVLVWTAIGWLRRASVPKQSAT |
Ga0179592_101328632 | 3300020199 | Vadose Zone Soil | MMHMMNESCGPLMIALMGAGWLFGLGLIGSLIVLAWTAVGRLRRTPAKA |
Ga0207684_100081697 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQMMNEACRPLMTAVMGLSWLLGLGLVVSLIVLVWTVVGRLRRTPAQS |
Ga0207684_102003432 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRRTPAEA |
Ga0207646_119070372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQMMNEACGPLMTAVMGLSWLLGLGLVVSLIVLVWTVVGRLRRTPAQS |
Ga0209236_12306532 | 3300026298 | Grasslands Soil | MMHMMNESCGPLMIALMGASWLLGLGLVASLIVLVWTAVGRLR |
Ga0209240_10629882 | 3300026304 | Grasslands Soil | MMHMMDMSCGPLMAVVGGISWLLGLGLVGSLTVLVWVVIGRLRRTPVGA |
Ga0209470_12212782 | 3300026324 | Soil | MMQMMNETCGPLMMAVMGLSWLLGLGLVVSLIVLVWTAIGRLRRTPTQS |
Ga0209152_100097904 | 3300026325 | Soil | MMHMMNESCGPFMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPAKA |
Ga0209267_11585051 | 3300026331 | Soil | MNESCGPLMIALMGLGWLLGLGLVASLIVLVWTAVGRLKQTPAKA |
Ga0209377_11662852 | 3300026334 | Soil | MLQMMNEACRPLMTAVMGLSWLLGLGLVVSVIVLVWAAIGRLRRTPTQS |
Ga0257168_10115312 | 3300026514 | Soil | MMHMMDMSCGPLMAVLGGISWLIGLVGSLTVLVWVVIGRLRRTPVGA |
Ga0257168_10833762 | 3300026514 | Soil | MHMMDGSCGPLMALIMGLGGLLSLGLVGSLIVLVWVTI |
Ga0209160_11033162 | 3300026532 | Soil | VSERRDSDMMHMMDGACGPLMIVVMGLSWLLGLGLVASLIVLVWTAIGRLRRTPVRS |
Ga0209058_11352493 | 3300026536 | Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGRLRSTPA |
Ga0209474_101300964 | 3300026550 | Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTAIGR |
Ga0209388_12058372 | 3300027655 | Vadose Zone Soil | MMQMMNGSCGPFMMIVGGLSWLLGLGLVVSLMVLVWTAIGWLRRAPTPRQSAT |
Ga0209588_10254532 | 3300027671 | Vadose Zone Soil | MVHMMNESCGPLMIALMGAGWLLGLGLIGSLIVLAWTAVGHLRRTPTKA |
Ga0209180_100039358 | 3300027846 | Vadose Zone Soil | MMHMMNETCGPLMMAVMGLSWLLGLALVVSLIVLVWAAIGRLRRPPTQS |
Ga0209283_100047413 | 3300027875 | Vadose Zone Soil | MMHMMNETCGPLMMAVMGLSWLFGLALVVSLIVLVWAAIGRLRRPPTQS |
Ga0209488_100070618 | 3300027903 | Vadose Zone Soil | MMHMMDGSCGPLMALIMGLGGLLSLGLVGSLIVLVWVTIGYLRRRPA |
Ga0209488_108762242 | 3300027903 | Vadose Zone Soil | MMHMMDMSCGPLMAVVGGISWLIGLGLVGSLTVLVWVVIGRLRRTPVGA |
Ga0137415_110179502 | 3300028536 | Vadose Zone Soil | MMHMMNESCGPLMIALMGVGWLLGLGLVGSLIVLVWTVIGRLRQTPAKA |
⦗Top⦘ |