Metagenome Family F076858

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F076858
Family Type	Metagenome
Number of Sequences	117
Average Sequence Length	37 residues
Representative Sequence	MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK
Number of Associated Samples	62
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	88.89 %
% of genes near scaffold ends (potentially truncated)	12.82 %
% of genes from short scaffolds (< 2000 bps)	63.25 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (56.410 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.205 % of family members)
Environment Ontology (ENVO)	Unclassified (64.103 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (64.103 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF13203	DUF2201_N	5.98
PF11775	CobT_C	5.13
PF07728	AAA_5	4.27
PF03237	Terminase_6N	3.42
PF00004	AAA	2.56
PF01612	DNA_pol_A_exo1	1.71
PF00092	VWA	1.71
PF13384	HTH_23	1.71
PF10765	Phage_P22_NinX	1.71
PF13481	AAA_25	0.85
PF13662	Toprim_4	0.85
PF01258	zf-dskA_traR	0.85
PF12705	PDDEXK_1	0.85
PF06067	DUF932	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG1734	RNA polymerase-binding transcription factor DksA	Transcription [K]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
All Organisms	root	All Organisms	43.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Viruses	superkingdom	All Organisms → Viruses	41.88 %
cellular organisms	root	All Organisms → cellular organisms	1.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	6.84 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.71 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	1.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	6.84 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	1.71 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.85 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	6.84 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	1.71 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.85 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.85 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Spiribacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter	0.85 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
unclassified Spiribacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter	0.85 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.85 %
Spiribacter sp. C176	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.41 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.85 %
Spiribacter sp. C176	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005527\|Ga0068876_10013616	Not Available	5268	Open in IMG/M
3300005581\|Ga0049081_10026571	All Organisms → Viruses → Predicted Viral	2199	Open in IMG/M
3300005581\|Ga0049081_10030013	All Organisms → Viruses → Predicted Viral	2065	Open in IMG/M
3300005582\|Ga0049080_10016058	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2604	Open in IMG/M
3300005582\|Ga0049080_10081722	All Organisms → Viruses → Predicted Viral	1105	Open in IMG/M
3300005662\|Ga0078894_10010766	All Organisms → Viruses	7189	Open in IMG/M
3300005662\|Ga0078894_10034002	All Organisms → Viruses → Predicted Viral	4223	Open in IMG/M
3300005662\|Ga0078894_10748557	Not Available	859	Open in IMG/M
3300005805\|Ga0079957_1013289	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6083	Open in IMG/M
3300005805\|Ga0079957_1069530	All Organisms → Viruses → Predicted Viral	2041	Open in IMG/M
3300008107\|Ga0114340_1000495	Not Available	63059	Open in IMG/M
3300008107\|Ga0114340_1023403	All Organisms → Viruses → Predicted Viral	2887	Open in IMG/M
3300008111\|Ga0114344_1203790	Not Available	623	Open in IMG/M
3300008116\|Ga0114350_1004461	Not Available	7102	Open in IMG/M
3300008116\|Ga0114350_1007642	Not Available	5822	Open in IMG/M
3300008116\|Ga0114350_1007792	Not Available	5880	Open in IMG/M
3300008116\|Ga0114350_1085636	Not Available	1034	Open in IMG/M
3300008116\|Ga0114350_1095293	Not Available	953	Open in IMG/M
3300008116\|Ga0114350_1116072	Not Available	814	Open in IMG/M
3300008116\|Ga0114350_1165625	Not Available	592	Open in IMG/M
3300008120\|Ga0114355_1218340	Not Available	593	Open in IMG/M
3300008259\|Ga0114841_1026719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6302	Open in IMG/M
3300008266\|Ga0114363_1001985	Not Available	11753	Open in IMG/M
3300008266\|Ga0114363_1005418	Not Available	8742	Open in IMG/M
3300008266\|Ga0114363_1012642	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	3926	Open in IMG/M
3300008266\|Ga0114363_1013797	Not Available	3719	Open in IMG/M
3300008266\|Ga0114363_1039340	All Organisms → Viruses → Predicted Viral	1941	Open in IMG/M
3300008266\|Ga0114363_1046368	Not Available	1750	Open in IMG/M
3300008266\|Ga0114363_1170017	Not Available	1035	Open in IMG/M
3300008267\|Ga0114364_1187719	Not Available	522	Open in IMG/M
3300008448\|Ga0114876_1090984	All Organisms → Viruses → Predicted Viral	1241	Open in IMG/M
3300008450\|Ga0114880_1243239	Not Available	567	Open in IMG/M
3300009085\|Ga0105103_10070410	Not Available	1787	Open in IMG/M
3300009168\|Ga0105104_10015519	Not Available	4601	Open in IMG/M
3300009168\|Ga0105104_10029785	All Organisms → Viruses → Predicted Viral	3082	Open in IMG/M
3300010354\|Ga0129333_10648624	Not Available	912	Open in IMG/M
3300010354\|Ga0129333_10696772	Not Available	874	Open in IMG/M
3300010354\|Ga0129333_10700027	Not Available	871	Open in IMG/M
3300010354\|Ga0129333_11087127	Not Available	668	Open in IMG/M
3300010370\|Ga0129336_10004919	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8269	Open in IMG/M
3300013005\|Ga0164292_10368162	Not Available	966	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10012903	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	8642	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10020584	Not Available	6235	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10694327	Not Available	537	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10180304	Not Available	1626	Open in IMG/M
3300015050\|Ga0181338_1034524	Not Available	764	Open in IMG/M
3300017707\|Ga0181363_1071210	Not Available	602	Open in IMG/M
3300017747\|Ga0181352_1026840	All Organisms → Viruses → Predicted Viral	1754	Open in IMG/M
3300017747\|Ga0181352_1035105	All Organisms → Viruses → Predicted Viral	1502	Open in IMG/M
3300017747\|Ga0181352_1057856	All Organisms → Viruses → Predicted Viral	1115	Open in IMG/M
3300017747\|Ga0181352_1175071	Not Available	559	Open in IMG/M
3300017747\|Ga0181352_1206234	Not Available	504	Open in IMG/M
3300017754\|Ga0181344_1012208	All Organisms → Viruses → Predicted Viral	2740	Open in IMG/M
3300017754\|Ga0181344_1104952	Not Available	819	Open in IMG/M
3300017754\|Ga0181344_1160208	Not Available	640	Open in IMG/M
3300017754\|Ga0181344_1208433	Not Available	547	Open in IMG/M
3300017761\|Ga0181356_1087276	Not Available	1029	Open in IMG/M
3300017774\|Ga0181358_1055265	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1492	Open in IMG/M
3300017777\|Ga0181357_1059550	All Organisms → Viruses → Predicted Viral	1479	Open in IMG/M
3300017780\|Ga0181346_1071210	Not Available	1382	Open in IMG/M
3300017785\|Ga0181355_1013792	All Organisms → Viruses → Predicted Viral	3550	Open in IMG/M
3300017785\|Ga0181355_1099590	All Organisms → Viruses → Predicted Viral	1203	Open in IMG/M
3300017785\|Ga0181355_1323145	Not Available	574	Open in IMG/M
3300019784\|Ga0181359_1032213	Not Available	2027	Open in IMG/M
3300021961\|Ga0222714_10068896	All Organisms → Viruses → Predicted Viral	2353	Open in IMG/M
3300021961\|Ga0222714_10110844	All Organisms → Viruses → Predicted Viral	1714	Open in IMG/M
3300021963\|Ga0222712_10106318	All Organisms → Viruses → Predicted Viral	1955	Open in IMG/M
3300022179\|Ga0181353_1047673	All Organisms → Viruses → Predicted Viral	1126	Open in IMG/M
3300022179\|Ga0181353_1062339	Not Available	963	Open in IMG/M
3300022179\|Ga0181353_1077695	Not Available	841	Open in IMG/M
3300022179\|Ga0181353_1118000	Not Available	637	Open in IMG/M
3300022190\|Ga0181354_1149667	Not Available	731	Open in IMG/M
3300022407\|Ga0181351_1085187	Not Available	1251	Open in IMG/M
3300027608\|Ga0208974_1036476	Not Available	1462	Open in IMG/M
3300027608\|Ga0208974_1037875	All Organisms → Viruses → Predicted Viral	1429	Open in IMG/M
3300027659\|Ga0208975_1131066	Not Available	710	Open in IMG/M
3300027697\|Ga0209033_1219227	Not Available	561	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1280463	Not Available	606	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1049316	All Organisms → Viruses → Predicted Viral	2295	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1117654	All Organisms → Viruses → Predicted Viral	1133	Open in IMG/M
3300027743\|Ga0209593_10156691	Not Available	816	Open in IMG/M
3300027804\|Ga0209358_10271000	Not Available	846	Open in IMG/M
3300027816\|Ga0209990_10001293	Not Available	21375	Open in IMG/M
3300027816\|Ga0209990_10005606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176	8502	Open in IMG/M
(restricted) 3300027970\|Ga0247837_1138309	All Organisms → Viruses → Predicted Viral	1105	Open in IMG/M
3300028025\|Ga0247723_1054968	All Organisms → Viruses → Predicted Viral	1122	Open in IMG/M
(restricted) 3300028553\|Ga0247839_1126741	All Organisms → Viruses → Predicted Viral	1156	Open in IMG/M
(restricted) 3300028569\|Ga0247843_1047584	All Organisms → Viruses → Predicted Viral	2464	Open in IMG/M
3300031758\|Ga0315907_10007442	Not Available	11408	Open in IMG/M
3300031758\|Ga0315907_10012485	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	8285	Open in IMG/M
3300031857\|Ga0315909_10006450	Not Available	13238	Open in IMG/M
3300031857\|Ga0315909_10056624	All Organisms → Viruses → Predicted Viral	3589	Open in IMG/M
3300031857\|Ga0315909_10109162	All Organisms → Viruses → Predicted Viral	2366	Open in IMG/M
3300031857\|Ga0315909_10114229	All Organisms → Viruses → Predicted Viral	2297	Open in IMG/M
3300031857\|Ga0315909_10242304	All Organisms → Viruses → Predicted Viral	1391	Open in IMG/M
3300031857\|Ga0315909_10303207	All Organisms → Viruses → Predicted Viral	1193	Open in IMG/M
3300031857\|Ga0315909_10464334	Not Available	886	Open in IMG/M
3300031857\|Ga0315909_10467620	Not Available	881	Open in IMG/M
3300031857\|Ga0315909_10540636	Not Available	794	Open in IMG/M
3300031857\|Ga0315909_10577983	Not Available	756	Open in IMG/M
3300031951\|Ga0315904_10883846	Not Available	724	Open in IMG/M
3300031951\|Ga0315904_10901113	Not Available	714	Open in IMG/M
3300031951\|Ga0315904_10935358	Not Available	695	Open in IMG/M
3300031963\|Ga0315901_10656574	Not Available	786	Open in IMG/M
3300032116\|Ga0315903_10407539	All Organisms → Viruses → Predicted Viral	1105	Open in IMG/M
3300033488\|Ga0316621_10122409	All Organisms → Viruses → Predicted Viral	1507	Open in IMG/M
3300033981\|Ga0334982_0033611	All Organisms → Viruses → Predicted Viral	2915	Open in IMG/M
3300034012\|Ga0334986_0056197	All Organisms → Viruses → Predicted Viral	2478	Open in IMG/M
3300034023\|Ga0335021_0161554	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1269	Open in IMG/M
3300034061\|Ga0334987_0636824	Not Available	623	Open in IMG/M
3300034062\|Ga0334995_0037727	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4077	Open in IMG/M
3300034092\|Ga0335010_0056162	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2801	Open in IMG/M
3300034106\|Ga0335036_0002476	Not Available	16097	Open in IMG/M
3300034106\|Ga0335036_0078973	All Organisms → Viruses → Predicted Viral	2452	Open in IMG/M
3300034106\|Ga0335036_0321910	Not Available	1020	Open in IMG/M
3300034106\|Ga0335036_0429116	Not Available	842	Open in IMG/M
3300034116\|Ga0335068_0194573	All Organisms → Viruses → Predicted Viral	1068	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.29%
Terrestrial	Environmental → Terrestrial	1.71%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	91.45%
Marine	Environmental → Aquatic → Marine	6.84%
Soil	Environmental → Terrestrial → Soil	0.85%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.85%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	39.32%
Lentic	Environmental → Aquatic → Freshwater → Lentic	34.19%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	14.53%
Coastal	Environmental → Aquatic → Marine → Coastal	4.27%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.42%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.56%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.85%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	39.32%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	34.19%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	14.53%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	4.27%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.85%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	28.21%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	18.80%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	17.09%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	14.53%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.98%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	4.27%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.42%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.56%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.71%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.71%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027970 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028553 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m	Environmental	Open in IMG/M
3300028569 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034023	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090	Environmental	Open in IMG/M
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068876_100136165	3300005527	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK*
Ga0049081_100265713	3300005581	Freshwater Lentic	MTEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK*
Ga0049081_100300132	3300005581	Freshwater Lentic	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK*
Ga0049080_100160588	3300005582	Freshwater Lentic	EIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK*
Ga0049080_100817225	3300005582	Freshwater Lentic	MTEIAEFLRALNGALGLIAIAFCVYFLASMFMGKGDK*
Ga0078894_1001076611	3300005662	Freshwater Lake	MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK*
Ga0078894_100340026	3300005662	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0078894_107485571	3300005662	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE*
Ga0079957_10132896	3300005805	Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACMFIGRNDK*
Ga0079957_10695304	3300005805	Lake	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE*
Ga0114340_100049536	3300008107	Freshwater, Plankton	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDGE*
Ga0114340_10234032	3300008107	Freshwater, Plankton	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK*
Ga0114344_12037903	3300008111	Freshwater, Plankton	GKMAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114350_100446112	3300008116	Freshwater, Plankton	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE*
Ga0114350_10076424	3300008116	Freshwater, Plankton	MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114350_10077925	3300008116	Freshwater, Plankton	MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE*
Ga0114350_10856363	3300008116	Freshwater, Plankton	MNEIAEFLRALNGALGLICIAIAVYFLACIVMGKGGDK*
Ga0114350_10952933	3300008116	Freshwater, Plankton	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK*
Ga0114350_11160723	3300008116	Freshwater, Plankton	MDEIAEFLRSLNGALGLIVVAICVYFLACMIMVRGDK*
Ga0114350_11656254	3300008116	Freshwater, Plankton	MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE*
Ga0114355_12183404	3300008120	Freshwater, Plankton	MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK*
Ga0114841_10267198	3300008259	Freshwater, Plankton	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDDK*
Ga0114363_100198522	3300008266	Freshwater, Plankton	MREFAEFLRMLNDALGLIAIAFCVYFLACILTSKGDKE*
Ga0114363_100541814	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK*
Ga0114363_10126427	3300008266	Freshwater, Plankton	MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE*
Ga0114363_10137975	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114363_10393408	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK*
Ga0114363_10463687	3300008266	Freshwater, Plankton	MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDDK*
Ga0114363_11700174	3300008266	Freshwater, Plankton	MSEIAEILRALNGALGLICIAFCVYFLACIISGGDK*
Ga0114364_11877192	3300008267	Freshwater, Plankton	MNEIAEFLRALNGALGLICIAVAVYFLACIVMGKGDDK*
Ga0114876_10909842	3300008448	Freshwater Lake	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGGDE*
Ga0114880_12432391	3300008450	Freshwater Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK*
Ga0105103_100704106	3300009085	Freshwater Sediment	MSEIAEFLRALNGALGLICIAFCVYFLACIVMGRGDKE*
Ga0105104_100155197	3300009168	Freshwater Sediment	MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK*
Ga0105104_100297853	3300009168	Freshwater Sediment	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE*
Ga0129333_106486244	3300010354	Freshwater To Marine Saline Gradient	MREFAELLRMFNDALGLILIAFCVYFLACIVMGRGDKE*
Ga0129333_106967723	3300010354	Freshwater To Marine Saline Gradient	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE*
Ga0129333_107000272	3300010354	Freshwater To Marine Saline Gradient	MNEVAEFLRALNGALGLIAIAFCVYFLACMFIGRGDK*
Ga0129333_110871273	3300010354	Freshwater To Marine Saline Gradient	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK*
Ga0129336_1000491913	3300010370	Freshwater To Marine Saline Gradient	MAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK*
Ga0164292_103681622	3300013005	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACMFIGRGDKE*
(restricted) Ga0172367_100129039	3300013126	Freshwater	MNEIAEVLKGLNAALGLICIAFCVYLIACILSGGDDK*
(restricted) Ga0172367_100205842	3300013126	Freshwater	MVEIAEFLRALNGALGLICIAIAVYFLACIVIGKGGDK*
(restricted) Ga0172367_106943272	3300013126	Freshwater	MVEIAEFLRALNGALGLICIAFCVYLLACILSGGKDK*
(restricted) Ga0172372_101803041	3300013132	Freshwater	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGKDK*
Ga0181338_10345244	3300015050	Freshwater Lake	MDEIAEFLRSLNGALGLIVVAICVYFLACMIIGRGEK*
Ga0181363_10712103	3300017707	Freshwater Lake	MDEIAEFLRLLNGALGLIVVAICVYFLACIIIGRGDDK
Ga0181352_10268405	3300017747	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE
Ga0181352_10351052	3300017747	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK
Ga0181352_10578563	3300017747	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIVMGRGDKE
Ga0181352_11750712	3300017747	Freshwater Lake	MSEIAEFLRMFNDALGLILIAFCVYFLACIVMGRGGDE
Ga0181352_12062341	3300017747	Freshwater Lake	MREFAEFLRMLNDALGLIAIAFCVYFLACILTSRGDKE
Ga0181344_10122085	3300017754	Freshwater Lake	MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKE
Ga0181344_11049521	3300017754	Freshwater Lake	GPVSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDDK
Ga0181344_11602081	3300017754	Freshwater Lake	LYRCPCDRRGRRTMREFAEFLQMLNSALGLIAIAFCVYFLACILTSKGDKE
Ga0181344_12084333	3300017754	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0181356_10872767	3300017761	Freshwater Lake	NEVAEFLQKLNGALGLIVVAICVYFLACMVIGRGDK
Ga0181358_10552651	3300017774	Freshwater Lake	MDDIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0181357_10595502	3300017777	Freshwater Lake	MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKK
Ga0181346_10712105	3300017780	Freshwater Lake	MDEIAEFLRALNGALGLIAVAFCVYFLACMIIGRGDK
Ga0181355_10137924	3300017785	Freshwater Lake	MSEIAEILRALNGALGLICIAFCVYFLACIISGGDDK
Ga0181355_10995902	3300017785	Freshwater Lake	MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0181355_13231452	3300017785	Freshwater Lake	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE
Ga0181359_10322133	3300019784	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0222714_100688965	3300021961	Estuarine Water	MSEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
Ga0222714_101108443	3300021961	Estuarine Water	MSEIVEILRALNGALGLICIAFCVYFLACIISGGDK
Ga0222712_101063188	3300021963	Estuarine Water	MSEIAEFLRALNGALGLICIAFCVYFLACLLTGGDDK
Ga0181353_10476733	3300022179	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKK
Ga0181353_10623393	3300022179	Freshwater Lake	MNEIAEFLRSLNGALGLICIAIAVYFLACIVMGKGGDK
Ga0181353_10776952	3300022179	Freshwater Lake	MNEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDK
Ga0181353_11180001	3300022179	Freshwater Lake	MVDIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
Ga0181354_11496672	3300022190	Freshwater Lake	MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE
Ga0181351_10851875	3300022407	Freshwater Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0208974_10364761	3300027608	Freshwater Lentic	MDEIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK
Ga0208974_10378754	3300027608	Freshwater Lentic	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK
Ga0208975_11310663	3300027659	Freshwater Lentic	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDK
Ga0209033_12192272	3300027697	Freshwater Lake	MVEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
(restricted) Ga0247836_12804633	3300027728	Freshwater	PMSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE
(restricted) Ga0247833_10493164	3300027730	Freshwater	MSEIAEILRALNGALGLICIAFCVYFLACIVIGRGDK
(restricted) Ga0247833_11176543	3300027730	Freshwater	MSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE
Ga0209593_101566911	3300027743	Freshwater Sediment	MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGG
Ga0209358_102710004	3300027804	Freshwater Lake	YRRGMRMAEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0209990_1000129334	3300027816	Freshwater Lake	MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0209990_100056066	3300027816	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK
(restricted) Ga0247837_11383092	3300027970	Freshwater	MSEIAEILRALNGALGLICIAICVYFLACIVIGRGDKE
Ga0247723_10549682	3300028025	Deep Subsurface Sediment	MSEVAEVLRALNGALGLICIAFCVYFLACIISGGDK
(restricted) Ga0247839_11267413	3300028553	Freshwater	MSEIAEILRALNGALGLICIAFCVYFLACIISGGGK
(restricted) Ga0247843_10475847	3300028569	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK
Ga0315907_1000744210	3300031758	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK
Ga0315907_100124856	3300031758	Freshwater	MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0315909_100064505	3300031857	Freshwater	MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0315909_100566249	3300031857	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE
Ga0315909_101091624	3300031857	Freshwater	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK
Ga0315909_101142294	3300031857	Freshwater	MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK
Ga0315909_102423044	3300031857	Freshwater	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK
Ga0315909_103032075	3300031857	Freshwater	MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE
Ga0315909_104643343	3300031857	Freshwater	MREIAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE
Ga0315909_104676201	3300031857	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE
Ga0315909_105406364	3300031857	Freshwater	VSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRG
Ga0315909_105779833	3300031857	Freshwater	MSEIAEALRMLNGALGLICIAVAVYFLACIVMGKGDDE
Ga0315904_108838462	3300031951	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE
Ga0315904_109011133	3300031951	Freshwater	MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDK
Ga0315904_109353582	3300031951	Freshwater	MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK
Ga0315901_106565743	3300031963	Freshwater	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDDK
Ga0315903_104075394	3300032116	Freshwater	MREFAEFLRMLNDALGLIAIAFCVYFLACIVMGRGDKE
Ga0316621_101224093	3300033488	Soil	MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK
Ga0334982_0033611_1662_1778	3300033981	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACIIIGRGDKE
Ga0334986_0056197_432_548	3300034012	Freshwater	MSEVAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE
Ga0335021_0161554_588_701	3300034023	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACILSGGDDK
Ga0334987_0636824_3_110	3300034061	Freshwater	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGD
Ga0334995_0037727_1102_1218	3300034062	Freshwater	MNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK
Ga0335010_0056162_3_131	3300034092	Freshwater	HGESMNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK
Ga0335036_0002476_6253_6369	3300034106	Freshwater	MSEIAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE
Ga0335036_0078973_1760_1873	3300034106	Freshwater	MSVIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0335036_0321910_208_324	3300034106	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE
Ga0335036_0429116_2_112	3300034106	Freshwater	AEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0335068_0194573_2_109	3300034116	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGD

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters