NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076781

Metagenome / Metatranscriptome Family F076781

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076781
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 68 residues
Representative Sequence LLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLQRSL
Number of Associated Samples 71
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.88 %
% of genes near scaffold ends (potentially truncated) 91.45 %
% of genes from short scaffolds (< 2000 bps) 95.73 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (59.829 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(76.923 % of family members)
Environment Ontology (ENVO) Unclassified
(48.718 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(94.017 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 64.21%    β-sheet: 0.00%    Coil/Unstructured: 35.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00063Myosin_head 0.85
PF04998RNA_pol_Rpb1_5 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0086DNA-directed RNA polymerase, beta' subunit/160 kD subunitTranscription [K] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A59.83 %
All OrganismsrootAll Organisms40.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009411|Ga0115017_1358092All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea652Open in IMG/M
3300010200|Ga0127507_1142216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea607Open in IMG/M
3300010870|Ga0102750_10540190All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea607Open in IMG/M
3300010874|Ga0136264_10165124Not Available728Open in IMG/M
3300010878|Ga0136899_10186138Not Available745Open in IMG/M
3300027860|Ga0209611_10061356All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea2841Open in IMG/M
3300028554|Ga0302047_10619624All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea607Open in IMG/M
3300030529|Ga0210284_1401860Not Available692Open in IMG/M
3300030531|Ga0210274_1333092Not Available594Open in IMG/M
3300030531|Ga0210274_1761364Not Available639Open in IMG/M
3300030531|Ga0210274_1884514All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea613Open in IMG/M
3300030535|Ga0210285_1267694Not Available712Open in IMG/M
3300030547|Ga0247656_1066397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea712Open in IMG/M
3300030548|Ga0210252_10725725Not Available697Open in IMG/M
3300030549|Ga0210257_10423558All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea685Open in IMG/M
3300030549|Ga0210257_10994636Not Available693Open in IMG/M
3300030554|Ga0247640_1202495Not Available511Open in IMG/M
3300030558|Ga0257197_1090965All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea530Open in IMG/M
3300030559|Ga0257205_1076002Not Available688Open in IMG/M
3300030562|Ga0257207_1056726Not Available621Open in IMG/M
3300030564|Ga0210256_10107040All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea736Open in IMG/M
3300030570|Ga0247647_1107202All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea701Open in IMG/M
3300030573|Ga0210272_1089976Not Available731Open in IMG/M
3300030575|Ga0210288_1266443All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea505Open in IMG/M
3300030577|Ga0210260_10151598All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea716Open in IMG/M
3300030579|Ga0247633_10087406All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea722Open in IMG/M
3300030579|Ga0247633_10166501Not Available621Open in IMG/M
3300030582|Ga0210261_1209196All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea517Open in IMG/M
3300030589|Ga0210255_10806655Not Available682Open in IMG/M
3300030589|Ga0210255_11163293Not Available691Open in IMG/M
3300030593|Ga0210263_1100470Not Available652Open in IMG/M
3300030594|Ga0210280_1089653Not Available644Open in IMG/M
3300030595|Ga0210276_10803442Not Available561Open in IMG/M
3300030595|Ga0210276_11189311Not Available663Open in IMG/M
3300030596|Ga0210278_1060576Not Available754Open in IMG/M
3300030598|Ga0210287_1187455Not Available563Open in IMG/M
3300030603|Ga0210253_10940560All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea564Open in IMG/M
3300030614|Ga0247657_10091493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea700Open in IMG/M
3300030615|Ga0257185_10145719Not Available728Open in IMG/M
3300030615|Ga0257185_10162604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea705Open in IMG/M
3300030615|Ga0257185_10181919All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea681Open in IMG/M
3300030622|Ga0265391_10120385Not Available698Open in IMG/M
3300030623|Ga0265392_1230392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea527Open in IMG/M
3300030624|Ga0210251_10143509All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea542Open in IMG/M
3300030625|Ga0210259_11835937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea588Open in IMG/M
3300030625|Ga0210259_11981306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea608Open in IMG/M
3300030626|Ga0210291_10713670Not Available686Open in IMG/M
3300030626|Ga0210291_10749402Not Available676Open in IMG/M
3300030626|Ga0210291_10752140Not Available688Open in IMG/M
3300030629|Ga0210268_1089488Not Available825Open in IMG/M
3300030629|Ga0210268_1095337All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea810Open in IMG/M
3300030630|Ga0210282_10109626Not Available764Open in IMG/M
3300030630|Ga0210282_10167087Not Available681Open in IMG/M
3300030630|Ga0210282_10344217All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea540Open in IMG/M
3300030632|Ga0210250_10914621Not Available640Open in IMG/M
3300030632|Ga0210250_11291442Not Available644Open in IMG/M
3300030632|Ga0210250_11469336Not Available741Open in IMG/M
3300030632|Ga0210250_11903862Not Available512Open in IMG/M
3300030633|Ga0247623_10099139All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea736Open in IMG/M
3300030633|Ga0247623_10212872Not Available592Open in IMG/M
3300030738|Ga0265462_10740862Not Available787Open in IMG/M
3300030738|Ga0265462_10944264Not Available731Open in IMG/M
3300030738|Ga0265462_11023834Not Available713Open in IMG/M
3300030738|Ga0265462_11030995Not Available711Open in IMG/M
3300030738|Ga0265462_11072113Not Available702Open in IMG/M
3300030740|Ga0265460_10886155Not Available801Open in IMG/M
3300030740|Ga0265460_11539580Not Available666Open in IMG/M
3300030740|Ga0265460_12915555Not Available514Open in IMG/M
3300030740|Ga0265460_12915954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea514Open in IMG/M
3300030741|Ga0265459_12173978Not Available672Open in IMG/M
3300030741|Ga0265459_12184688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Ostreococcus → Ostreococcus tauri671Open in IMG/M
3300030741|Ga0265459_12980192Not Available591Open in IMG/M
3300030743|Ga0265461_11368119Not Available751Open in IMG/M
3300030743|Ga0265461_11491340Not Available730Open in IMG/M
3300030743|Ga0265461_11548791Not Available721Open in IMG/M
3300030743|Ga0265461_11606613Not Available712Open in IMG/M
3300030743|Ga0265461_11792465All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea687Open in IMG/M
3300030743|Ga0265461_12511149Not Available607Open in IMG/M
3300030743|Ga0265461_13614885All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea524Open in IMG/M
3300030748|Ga0074043_11404127Not Available668Open in IMG/M
3300030755|Ga0074023_1878968Not Available614Open in IMG/M
3300030848|Ga0075388_11256051All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea709Open in IMG/M
3300030850|Ga0075387_10971662Not Available615Open in IMG/M
3300030931|Ga0074006_11595209Not Available634Open in IMG/M
3300030933|Ga0074039_11588601Not Available697Open in IMG/M
3300030944|Ga0074009_10005647Not Available705Open in IMG/M
3300030950|Ga0074034_11284225Not Available732Open in IMG/M
3300030959|Ga0102747_11139908All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea632Open in IMG/M
3300030959|Ga0102747_11244589All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea571Open in IMG/M
3300030968|Ga0075376_11410712All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea516Open in IMG/M
3300030972|Ga0075400_11946263Not Available683Open in IMG/M
3300031008|Ga0074038_11381280Not Available682Open in IMG/M
3300031020|Ga0074016_1219764Not Available702Open in IMG/M
3300031034|Ga0074041_11328538All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea536Open in IMG/M
3300031057|Ga0170834_101118937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea701Open in IMG/M
3300031057|Ga0170834_101750155Not Available662Open in IMG/M
3300031057|Ga0170834_105606978All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea741Open in IMG/M
3300031057|Ga0170834_106023525Not Available633Open in IMG/M
3300031057|Ga0170834_110924959Not Available682Open in IMG/M
3300031122|Ga0170822_11491193All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea707Open in IMG/M
3300031122|Ga0170822_14571534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea517Open in IMG/M
3300031128|Ga0170823_10706986All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea511Open in IMG/M
3300031231|Ga0170824_106944866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea699Open in IMG/M
3300031411|Ga0102761_10044683Not Available639Open in IMG/M
3300031411|Ga0102761_10152271All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea685Open in IMG/M
3300031411|Ga0102761_11960937Not Available738Open in IMG/M
3300031469|Ga0170819_17982796All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea533Open in IMG/M
3300032756|Ga0315742_10896098All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea857Open in IMG/M
3300032756|Ga0315742_11445206Not Available730Open in IMG/M
3300032756|Ga0315742_11627531All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea699Open in IMG/M
3300032756|Ga0315742_11951807Not Available651Open in IMG/M
3300032756|Ga0315742_13199773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea528Open in IMG/M
3300033542|Ga0314769_1169366All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea732Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil76.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil14.53%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated5.98%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.71%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010874Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)EnvironmentalOpen in IMG/M
3300010878Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030554Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030558Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2E (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030559Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030562Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-2W (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030568Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030755Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030931Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030944Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030950Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031020Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031021Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0115017_135809213300009411SoilVPVVPVPPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDTDNGASGYYVNMVMLLAALCFAGYHKLRRSL*
Ga0127507_114221623300010200Host-AssociatedMGLLGLFAAFVAVTAYLGDVYRALRDAGNVETGGAPGLNINMAILLAALCFAGFHKLQRSL*
Ga0102750_1054019013300010870SoilLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL*
Ga0136264_1016512413300010874SoilLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLQRSL*
Ga0136899_1018613813300010878SoilLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLQRSL*
Ga0209611_1006135643300027860Host-AssociatedMGLLGLFAAFVAVTAYLGKILHKILEWDFSXIFSXIFLGDVYRALRDAGNVETGGAPGLNINMAILLAALCFAGFHKLQRSL
Ga0302047_1061962413300028554SoilLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL
Ga0210284_140186013300030529SoilLLLCLLCLATLGLLGLFAAFIAVTAYLGSVYRALKAAGNDASGLYINMGVLLAALCFAGFQKLPRSL
Ga0210274_133309213300030531SoilPPPRRSGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGGASGLYMNMAILLAALGFVGYQKLRRSL
Ga0210274_176136413300030531SoilGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210274_188451413300030531SoilLLGLFAAFIAVTAYLAKVYHALQAAGSGASVQYANMAILLAALCFAGYHKLRRSL
Ga0210285_126769413300030535SoilLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0247656_106639713300030547SoilLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDVGGNASGLYANMAILLAALCFAGYHKLRRSL
Ga0210252_1072572513300030548SoilTGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDAGNAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210257_1042355813300030549SoilLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLRRSL
Ga0210257_1099463613300030549SoilLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0247640_120249523300030554SoilLCLATLGLLGLFGAFIAVTAYLGGVYRALRDSNGAASGLYVNMAILLAAVGFAFFHKLQRAL
Ga0257197_109096523300030558Host-AssociatedAPPPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILMAAVCFAGYHKIRRAL
Ga0257205_107600213300030559Host-AssociatedLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0257207_105672613300030562Host-AssociatedATFIAVTAYLGGVYRALRSAGNAASGHYVNMVILLAALCFVGFHKLRRSL
Ga0210256_1010704023300030564SoilPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLRRSL
Ga0257206_106994923300030568Host-AssociatedFAAFIAVTAYLGQVYRALRDVNNGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0247647_110720233300030570SoilGNQYVIPQRRPNRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDVGNSASGHYMNMTILLVALCFAGYHKLRRSL
Ga0210272_108997613300030573SoilPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0210288_126644313300030575SoilLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0210260_1015159823300030577SoilPSRGLAGIIGGLAGLLLFLLCLATLGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYVNMVVLVAALCFAGYHKLRRSL
Ga0247633_1008740623300030579SoilIPVAPRRGHGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDVGNSASGHYMNMTILMVALCFAGYHKLRRSL
Ga0247633_1016650133300030579SoilLGLLGLFATFIAVTAYLGDVYRALRDLNNGASGLYINMAILLAALCFAGLHKLHRSL
Ga0210261_120919613300030582SoilLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0210255_1080665513300030589SoilGLLGLFATFGAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210255_1116329313300030589SoilLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALKNANAAPGLYVNMVILLAGLSFAAYNKMRRSL
Ga0210263_110047013300030593SoilAYLGGVYRALRNNRTGAASALSVNMVILLAAICFAGFHKLRRSL
Ga0210280_108965313300030594SoilGLFAAFISVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210276_1080344213300030595SoilLLGGLAGLLLCLLCLATLGLIALFAIFVAVVAYLGQVYRALRDVNGGNSASGLYINMTILLAALCFASFHKLQRLL
Ga0210276_1118931113300030595SoilLGLFAAFVAVTAYLAEVYHALRSVGNSASGLYINMVILLAALCFAGFHKLQRSL
Ga0210278_106057623300030596SoilLFATFIAVTAYLGGVYRALRNNRTGGASGLYMNMAILLAALGFVGYQKLRRSL
Ga0210287_118745513300030598SoilGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDAGNSASGHYVNMVILLAALGFVGYQKLRRSL
Ga0210253_1094056023300030603SoilVLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0247657_1009149323300030614SoilPVVPVAAPRSRGLGGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRSLRDAGNSASGYYVNMAILLAALCFAGYHKLRRSL
Ga0257185_1014571923300030615Host-AssociatedGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNNASGLYVNMAILLAALCFAGFHKLQRAL
Ga0257185_1016260423300030615Host-AssociatedLAGLLGGLAGLLLCLLCLAALGLLGLFATFIAVTAYLGDVWRALRDNNNNAAVGIYFNSFILIAALCFAGYYKLQRSL
Ga0257185_1018191913300030615Host-AssociatedAALGLLALFATFIAVTAYLGDVYRALRNNRTGTASGLNVNMIILLAAVCFAGFHKLRRSL
Ga0265391_1012038523300030622SoilLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALISIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0265392_123039213300030623SoilLVLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210251_1014350913300030624SoilPPPPVARRSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYVNMAILLAALCFAGYHKLRRSL
Ga0210259_1183593713300030625SoilGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0210259_1198130623300030625SoilGLLGLFATFIAVTKYLGDVYRALKTLGNGTPGLYANMAILLAALCFAGYHKLRRSL
Ga0210291_1071367033300030626SoilCLATLGLLGLFATFVAVTAFLGDVYRALRDAGSGTGGASGLYVNMAILLVALCFAGFHKLQRSL
Ga0210291_1074940213300030626SoilPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSSTAPGLYANMTILLAALCFAGFLKLRRSL
Ga0210291_1075214013300030626SoilLGLLGLFAAFIATTAYLGGVYRALRSIGNSANVPVVNMAILLAALCFAGFYKLRRSL
Ga0210268_108948813300030629SoilGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNSANVPVVNMAILLAALCFAGFYKLRRSL
Ga0210268_109533723300030629SoilRRVGVRPIPRPVAARAQSGGLLGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGNVYRALRNLNAAPGLYINMGILMAALCFACYHKLQRSL
Ga0210282_1010962613300030630SoilPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNSANVPVVNMAILLAALCFAGFYKLRRSL
Ga0210282_1016708713300030630SoilLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210282_1034421713300030630SoilLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0210250_1091462113300030632SoilGLFAAFVAVTAYLGGVYRALRNANAAPGLYVNMVILLAALSFAAYNKMRRSL
Ga0210250_1129144223300030632SoilGLFATFIAVTKYLGDVYRALKATGSGASGLYMNMAILLAALCFAGFYKLRRSL
Ga0210250_1146933623300030632SoilLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0210250_1190386213300030632SoilLAGLLLCLLCLATLGLLGLFAAFVAVTAYLAEVYHALRSVGNSASGLYINMVILLAALCFAGFHKLQRSL
Ga0247623_1009913923300030633SoilAPRSRGLGGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRSLRDAGNSASGYYVNMAILLAALCFAGYHKLRRSL
Ga0247623_1021287213300030633SoilGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYKALRDTGSGASGLYINTVILLAALCFAGFHKLQRSL
Ga0265462_1074086223300030738SoilPRPPPPRPARGGLMGLLGGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALRDSNAASGLYVNMVILLAALCFAGFHKVRRSL
Ga0265462_1094426423300030738SoilASLIGGLAGLLLCLLCLAAMGLLGLFAAFIAATAYLGRIYRDLKSSGPGLDINMTVLLAALCFAGFYKLRRSL
Ga0265462_1102383423300030738SoilVLLCLLCLATNGLLGLFSAFVAVTAYLASVYHALRALGSGASGLHINTAILLAALCFAGFHKLQRSL
Ga0265462_1103099523300030738SoilLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSSTAPGLYANMTILLAALCFAGFLKLRRSL
Ga0265462_1107211313300030738SoilLIGGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGDVYRALRDAGSNASGLYVNMAVLLAALCFAGFHKLQRSL
Ga0265460_1088615513300030740SoilRPAPPPAAGRGGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0265460_1153958023300030740SoilGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGGASGLYMNMAILLVALGFVGYQKLRRSL
Ga0265460_1291555513300030740SoilLLCLATLGLLGLFSAFVAVTASLGGVYRALRNANNGASGLYINMFILLAALCFAGFHKVRRSL
Ga0265460_1291595413300030740SoilLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRNTGSSAPGLYMNMTILLAALCFAGYHKLRRSL
Ga0265459_1217397823300030741SoilRGGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0265459_1218468823300030741SoilGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGSVYRALRSAGGASGLYVNMAILLAALCFAGYHKLRRSL
Ga0265459_1298019213300030741SoilPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGGASGLYMNMAILLVALGFVGYQKLRRSL
Ga0265461_1136811933300030743SoilVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLAEVYHALRSVGNSASGLYINMVILLAALCFAGFHKLQRSL
Ga0265461_1149134013300030743SoilGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0265461_1154879133300030743SoilLAGLLGGLAGLLLCLLCLAAMGLLGLFAAFIAATAYLGNIYRDLNNSGPALYVNMSVLLVALCFASFYKLRRSL
Ga0265461_1160661313300030743SoilLATLGLLGLFATFIAVTAYLGGVYRALNAIGGASGHEVNMAILLAGLCFVGFYKLRRSL
Ga0265461_1179246513300030743SoilLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDAGNAGNSASSLYVNMAILLAALCFAGYHKLRRSL
Ga0265461_1251114913300030743SoilAGLLLCLLCLATMGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0265461_1361488523300030743SoilGGLLGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGNVYRALRNLNAAPGLYINMGILMAALCFACYHKLQRSL
Ga0074043_1140412723300030748SoilATLGLLGLFATFIAVTAYLGDIYRALRSAGNGASGLYINMVILLAALCFAGFHKLQRSL
Ga0074023_187896823300030755SoilLCLAALGLLGLFAAFVAVTAYLGDVYRALKNSRASGLYVNMAILLAALCFAVFNKLQRSL
Ga0075388_1125605113300030848SoilGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0075387_1097166213300030850SoilCLATLGLLGLFASFIAVTAYLGDVYRALKSAGGSANGLYVNMTILLAALCFAGFLKLRRS
Ga0074006_1159520923300030931SoilLAALGLLALFATFIAVTAYLGSVYRAMRNNRTGAASGLYMNMAMLLAALCFVGYQKLRRS
Ga0074039_1158860133300030933SoilCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYMNMAILLAALCFAGLHKLRRSL
Ga0074009_1000564713300030944SoilGLAGLLGGLAGLLLCLLCLAALGLLALFATFIAVTAYLGAVYRALRNNRTGAAPGLYMNMALVMAALCFVGFQKLRRSL
Ga0074034_1128422513300030950SoilGLLSGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALRDANAASGLYVNMVILLAALCFAGFHKMRRSL
Ga0102747_1113990823300030959SoilLGLFATFIAVTAYLGDVYRSLRDAGNTASGYNLNMAILLAALCFAGYHKLRRSL
Ga0102747_1124458913300030959SoilAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL
Ga0075376_1141071213300030968SoilLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0075400_1194626323300030972SoilTMGLLGLFAAFIAVTAYLGGVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0074038_1138128023300031008SoilGLFATFIAVTAYLGDIYRALRSAGNGASGLYINMVILLAALCFAGFHKLQRSL
Ga0074016_121976423300031020SoilGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGGVYRALRNNRTGAASALSVNMVILLAAVCFAGFHKLRRSL
Ga0102765_1158695323300031021SoilCLATLGLLGLFAAFIAVTAYLGDVYRALKNINGNSAAAIYVNVTMIFLALCFVSLHKLFR
Ga0074041_1132853833300031034SoilLCLATLGLLGLFATFIAVTAYLGSIYHALKTAGGSASGLYVNMTILLAALCFAGYHKLRRSL
Ga0170834_10111893713300031057Forest SoilLLGLLGGLAGLLLCLLCLATFGLLGLFATFIAVTAYLGDVWRALRSANGSPAGQYVNMTIVLAALCFVGYHKLRRSL
Ga0170834_10175015513300031057Forest SoilGLLGLFAAFIAVTAYLGDVYRALKSAGGAAPGLYVNMAVLFAALFFAVYHKLQRSL
Ga0170834_10560697823300031057Forest SoilGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDSGSSAASGLYVNMTILLAALCFAGFHKLRRSL
Ga0170834_10602352513300031057Forest SoilGLLGLFATFVAVTAYLGDVYRALKDAGNSASGFYVNMVILLAALCFAGFHKLQRSL
Ga0170834_11092495913300031057Forest SoilLLCLLCLATLGLLGLFASFIAVTAYLGDVYRALKSAGGSANGLYVNMTILLAALCFAGFLKLRRSL
Ga0170822_1149119313300031122Forest SoilAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGASSTASGLYVNMTILLAALCFAGFHKLRRSL
Ga0170822_1457153413300031122Forest SoilGGLAGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDAGTGGASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170823_1070698623300031128Forest SoilAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGASSTASGLYVNMTILLAALCFAGFHKLRRSL
Ga0170823_1589646123300031128Forest SoilLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0170824_10694486613300031231Forest SoilGGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGNSASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0102761_1004468333300031411SoilATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0102761_1015227113300031411SoilLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRSLKDAGNSASGYYVNMAILLVALCFAGYHKLRRSL
Ga0102761_1196093723300031411SoilGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRRANAASGLYVNVFILFIALGFACFNKFRRSL
Ga0170819_1798279613300031469Forest SoilGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGNSASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0315741_1130995513300032739Forest SoilFIALTVYLGDVYRALKNAVNNASGLYINTVILLAALCFAGFHKLQRSL
Ga0315742_1089609823300032756Forest SoilMGLLGGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALRDANAASGLYVNMVILLAALCFAGFHKMRRSL
Ga0315742_1144520623300032756Forest SoilPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALQATGSSASGLYINMAILLAALCFAGFYKLRRSL
Ga0315742_1162753113300032756Forest SoilARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNSASGLYVNMAILLAALCFAGFHKLRRSL
Ga0315742_1195180713300032756Forest SoilGLFAAFVAVTAYLAEVYHALRSVGNSASGLYINMVILLAALCFAGFHKLQRSL
Ga0315742_1319977313300032756Forest SoilLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGYYVNMIVLVAALCFAGYHKLRRSL
Ga0314769_116936613300033542Switchgrass PhyllospherePKARTGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDVGGNASGLYANMAILLAALCFAGYHKLRRSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.