NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076529

Metagenome / Metatranscriptome Family F076529

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076529
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 45 residues
Representative Sequence PAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Number of Associated Samples 102
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 97.46 %
% of genes from short scaffolds (< 2000 bps) 96.61 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.593 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.034 % of family members)
Environment Ontology (ENVO) Unclassified
(32.203 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.373 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.66%    Coil/Unstructured: 75.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF06999Suc_Fer-like 8.47
PF03483B3_4 5.08
PF06305LapA_dom 0.85
PF14026DUF4242 0.85
PF00873ACR_tran 0.85
PF02784Orn_Arg_deC_N 0.85
PF14833NAD_binding_11 0.85
PF06276FhuF 0.85
PF03551PadR 0.85
PF13751DDE_Tnp_1_6 0.85
PF03949Malic_M 0.85
PF13358DDE_3 0.85
PF00521DNA_topoisoIV 0.85
PF12680SnoaL_2 0.85
PF00561Abhydrolase_1 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG4759Uncharacterized conserved protein, contains thioredoxin-like domainGeneral function prediction only [R] 8.47
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 0.85
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.85
COG0281Malic enzymeEnergy production and conversion [C] 0.85
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.85
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 0.85
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.85
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.85
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.85
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 0.85
COG4114Ferric iron reductase protein FhuF, involved in iron transportInorganic ion transport and metabolism [P] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.59 %
UnclassifiedrootN/A14.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100504465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1087Open in IMG/M
3300003505|JGIcombinedJ51221_10452948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura519Open in IMG/M
3300004092|Ga0062389_101588330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia836Open in IMG/M
3300004479|Ga0062595_102351883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300004635|Ga0062388_101784391All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005436|Ga0070713_101228733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300005436|Ga0070713_102260931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata526Open in IMG/M
3300005549|Ga0070704_101656293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300005560|Ga0066670_10898253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales539Open in IMG/M
3300005591|Ga0070761_10119014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1532Open in IMG/M
3300005614|Ga0068856_100399915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1393Open in IMG/M
3300005614|Ga0068856_101101675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300005764|Ga0066903_106940944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales588Open in IMG/M
3300006028|Ga0070717_11430399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300006028|Ga0070717_11575588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300006163|Ga0070715_10808061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300006175|Ga0070712_100812734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia802Open in IMG/M
3300006175|Ga0070712_101955959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300006237|Ga0097621_102400989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae505Open in IMG/M
3300006954|Ga0079219_10768394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora setae749Open in IMG/M
3300009545|Ga0105237_10757228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300009672|Ga0116215_1076163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1510Open in IMG/M
3300009700|Ga0116217_10090943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2103Open in IMG/M
3300010373|Ga0134128_12402125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300010375|Ga0105239_10418551All Organisms → cellular organisms → Bacteria → Terrabacteria group1517Open in IMG/M
3300010876|Ga0126361_11051870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300012357|Ga0137384_10585700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales911Open in IMG/M
3300013308|Ga0157375_12247227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300014150|Ga0134081_10314447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300014169|Ga0181531_10283916Not Available1012Open in IMG/M
3300014968|Ga0157379_10221675All Organisms → cellular organisms → Bacteria → Terrabacteria group1714Open in IMG/M
3300014968|Ga0157379_10438282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1205Open in IMG/M
3300016294|Ga0182041_10940231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae779Open in IMG/M
3300016341|Ga0182035_10368152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1199Open in IMG/M
3300016341|Ga0182035_10782236All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300016341|Ga0182035_11732872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae565Open in IMG/M
3300016371|Ga0182034_10943028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300016387|Ga0182040_11666825All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300016422|Ga0182039_10289335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1352Open in IMG/M
3300016422|Ga0182039_10539892All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300016422|Ga0182039_11936463Not Available541Open in IMG/M
3300017821|Ga0187812_1024611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2074Open in IMG/M
3300017928|Ga0187806_1391070Not Available500Open in IMG/M
3300017942|Ga0187808_10595206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae514Open in IMG/M
3300017970|Ga0187783_10302105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1167Open in IMG/M
3300017973|Ga0187780_10289074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1151Open in IMG/M
3300017973|Ga0187780_11024269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus602Open in IMG/M
3300017975|Ga0187782_10348992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1120Open in IMG/M
3300017975|Ga0187782_11092650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales622Open in IMG/M
3300017995|Ga0187816_10114837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1159Open in IMG/M
3300017995|Ga0187816_10180538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae916Open in IMG/M
3300018001|Ga0187815_10082975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1348Open in IMG/M
3300018001|Ga0187815_10255182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales742Open in IMG/M
3300018058|Ga0187766_10797926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae659Open in IMG/M
3300018089|Ga0187774_10588282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300020580|Ga0210403_11273469Not Available563Open in IMG/M
3300020582|Ga0210395_10557207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae861Open in IMG/M
3300021384|Ga0213876_10648500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia562Open in IMG/M
3300021403|Ga0210397_10695175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales781Open in IMG/M
3300021474|Ga0210390_11096073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales647Open in IMG/M
3300022709|Ga0222756_1060271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae586Open in IMG/M
3300025898|Ga0207692_10360524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia898Open in IMG/M
3300025914|Ga0207671_11117326Not Available619Open in IMG/M
3300025914|Ga0207671_11504528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300025915|Ga0207693_10217294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1502Open in IMG/M
3300025916|Ga0207663_11684978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura alba510Open in IMG/M
3300025917|Ga0207660_11033148Not Available670Open in IMG/M
3300025928|Ga0207700_10347444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1291Open in IMG/M
3300025929|Ga0207664_10972130Not Available761Open in IMG/M
3300025938|Ga0207704_10353750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1144Open in IMG/M
3300025941|Ga0207711_11406273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300025961|Ga0207712_11590805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae586Open in IMG/M
3300026300|Ga0209027_1287066Not Available530Open in IMG/M
3300027047|Ga0208730_1012298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae929Open in IMG/M
3300027096|Ga0208099_1002400All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300027680|Ga0207826_1016876All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300027855|Ga0209693_10278453All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300027889|Ga0209380_10619989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales625Open in IMG/M
3300028379|Ga0268266_11697355Not Available607Open in IMG/M
3300030494|Ga0310037_10416791Not Available554Open in IMG/M
3300030730|Ga0307482_1198517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria608Open in IMG/M
3300031544|Ga0318534_10683390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae580Open in IMG/M
3300031561|Ga0318528_10362060Not Available779Open in IMG/M
3300031640|Ga0318555_10660934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales565Open in IMG/M
3300031713|Ga0318496_10799525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales520Open in IMG/M
3300031719|Ga0306917_10987432All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300031744|Ga0306918_11442630Not Available527Open in IMG/M
3300031748|Ga0318492_10169332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1108Open in IMG/M
3300031751|Ga0318494_10133625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1389Open in IMG/M
3300031753|Ga0307477_10681275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300031781|Ga0318547_10705900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales627Open in IMG/M
3300031798|Ga0318523_10267765All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300031799|Ga0318565_10664614Not Available500Open in IMG/M
3300031805|Ga0318497_10106543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1508Open in IMG/M
3300031819|Ga0318568_10344370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae927Open in IMG/M
3300031879|Ga0306919_10550263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae890Open in IMG/M
3300031894|Ga0318522_10161295Not Available846Open in IMG/M
3300031897|Ga0318520_10150703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1348Open in IMG/M
3300031910|Ga0306923_10810688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1033Open in IMG/M
3300031910|Ga0306923_11121005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae846Open in IMG/M
3300031942|Ga0310916_10683938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae869Open in IMG/M
3300031942|Ga0310916_11596092Not Available530Open in IMG/M
3300031947|Ga0310909_10662664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae869Open in IMG/M
3300031954|Ga0306926_11731791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae712Open in IMG/M
3300032010|Ga0318569_10053944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1745Open in IMG/M
3300032065|Ga0318513_10541396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae570Open in IMG/M
3300032067|Ga0318524_10207118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1003Open in IMG/M
3300032076|Ga0306924_11242758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae803Open in IMG/M
3300032180|Ga0307471_103659660Not Available544Open in IMG/M
3300032205|Ga0307472_100552969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1005Open in IMG/M
3300032261|Ga0306920_103070553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae628Open in IMG/M
3300032770|Ga0335085_12031334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales582Open in IMG/M
3300032829|Ga0335070_10605634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1030Open in IMG/M
3300032954|Ga0335083_10431363All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300033289|Ga0310914_10678039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae926Open in IMG/M
3300033290|Ga0318519_10186690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1177Open in IMG/M
3300034163|Ga0370515_0085602All Organisms → cellular organisms → Bacteria1366Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.39%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.39%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.54%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10050446523300002245Forest SoilAQAXPAGVDVVEAGWPAGQPASASWPKHPAGWRIVASDQAAGWVAWRHS*
JGIcombinedJ51221_1045294813300003505Forest SoilAPPAGVDVVETGWPAGQPASAGWPNHPAGWRIVASNQAAGWVAWRHS*
Ga0062389_10158833023300004092Bog Forest SoilEPEVFNPASQSPPAGVTVVQMPWTAGQPARSSWPHAPAGWRIAASDASSGWVVWRKA*
Ga0062595_10235188313300004479SoilLPAGTTVVETGWPAGKPAEAGWPNAPAGWRIVASNQDLGWVVWRQG*
Ga0062388_10178439113300004635Bog Forest SoilELEFFNPAQAPPAGVSVVETGWPTGQPASAGWAHHPAGWRIVASNQAAGWVAWRHS*
Ga0070713_10122873313300005436Corn, Switchgrass And Miscanthus RhizospherePAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG*
Ga0070713_10226093113300005436Corn, Switchgrass And Miscanthus RhizospherePAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0070704_10165629323300005549Corn, Switchgrass And Miscanthus RhizosphereTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG*
Ga0066670_1089825323300005560SoilVIWRSFPGRAHPLLAGTTVVETGWPVGEPAQAGWPDAPAGWRIVASDQDVGWVVWRQG*
Ga0070761_1011901423300005591SoilSVVETGWPTGQPASASWPQHPAGWRIVASNQAAGWVAWRHS*
Ga0068856_10039991513300005614Corn RhizosphereGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0068856_10110167523300005614Corn RhizosphereGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0066903_10694094423300005764Tropical Forest SoilVNVVETGWPSGQAAAAGWPNHPAGWRIVAANQAAGWVAWRKS*
Ga0070717_1143039913300006028Corn, Switchgrass And Miscanthus RhizosphereQPLPPGTTVVEAGWPTGQPAQAGWPEAPAGWRIVASDQSAGWAVWRKG*
Ga0070717_1157558813300006028Corn, Switchgrass And Miscanthus RhizosphereTGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0070715_1080806123300006163Corn, Switchgrass And Miscanthus RhizosphereQPLPPGTTVVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA*
Ga0070712_10081273413300006175Corn, Switchgrass And Miscanthus RhizosphereHQALPPGTTVVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA*
Ga0070712_10195595913300006175Corn, Switchgrass And Miscanthus RhizosphereTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0097621_10240098913300006237Miscanthus RhizosphereQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0079219_1076839413300006954Agricultural SoilEAGWPTGKPAQAGWPQAPAGWRIVASDQSAGWVVWRKA*
Ga0105237_1075722833300009545Corn RhizosphereRQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG*
Ga0116215_107616313300009672Peatlands SoilELEFFNPAQAPPAGVNVVETGWPAGQPASAGWPVHPAGWRIVASNQAAGWVAWRKS*
Ga0116217_1009094313300009700Peatlands SoilPSGQPASAGWPNHPAGWRIVAANQAAGWVAWRKS*
Ga0134128_1240212523300010373Terrestrial SoilLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG*
Ga0105239_1041855123300010375Corn RhizospherePAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG*
Ga0126361_1105187023300010876Boreal Forest SoilWTTGQPASASWPQHPAGWRIVASDRTDGWVVWRRA*
Ga0137384_1058570013300012357Vadose Zone SoilPPAGVSVVEAAWPAGQDARAGWPDAPAGWRIVASDQASAWVLWRKS*
Ga0157375_1224722713300013308Miscanthus RhizosphereRQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG*
Ga0134081_1031444723300014150Grasslands SoilGWPTGQPARAGWSQAPAGWQIVASDQSAGWVVWRKG*
Ga0181531_1028391623300014169BogAQAPPAGVNVVETGWPSGQPASAGWPDRPAGWRIVASNQAAGWVAWRKS*
Ga0157379_1022167513300014968Switchgrass RhizosphereTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG*
Ga0157379_1043828213300014968Switchgrass RhizosphereRQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG*
Ga0182041_1094023123300016294SoilGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLAPGR
Ga0182035_1036815223300016341SoilWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA
Ga0182035_1078223633300016341SoilGWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRRG
Ga0182035_1173287213300016341SoilVVETGWPAGPPASAGWPDHPAGWQIVASNQAAGWVAWRLAPGR
Ga0182034_1094302813300016371SoilPFTSDGQPLPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQNAGWVVWRKG
Ga0182040_1166682513300016387SoilGWPTGQSAQAGWPEAPAGWRIIASDQAAGWVVWRQG
Ga0182039_1028933533300016422SoilLPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQNAGWVVWRKG
Ga0182039_1053989213300016422SoilSAWPTGQPAQAGWPQAPAGWRIVASDQGAGWVIWRKG
Ga0182039_1193646323300016422SoilEFFDITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA
Ga0187812_102461123300017821Freshwater SedimentVNVVETGWPAGQPASAGWPEHPAGWRIVAANQAAGWVAWRKS
Ga0187806_139107013300017928Freshwater SedimentNPAQPPPAGVNVVETGWPAGQTASAGWLDHPAGWRIVASNQAAGWVAWRKS
Ga0187808_1059520613300017942Freshwater SedimentTDVEFFNPTQAPPAGTTVVETGWPAGQPAWSGWPNHRAGWHIVAANQAAGWVAWRKS
Ga0187783_1030210533300017970Tropical PeatlandPPAGVNVVEAGWPVGQPAQASWPHAPAGWRIVASSQAGGWVVWRKAPVS
Ga0187780_1028907423300017973Tropical PeatlandGQPASAGWPDHPAGWRIVASNQAAGWVAWRLAPGRLSW
Ga0187780_1102426923300017973Tropical PeatlandGINVVETGWPTGQPASASWPNHPAGWRIVASNQAAGWVAWRES
Ga0187782_1034899223300017975Tropical PeatlandFDSTQAPPPGVNVVEAGWPAGQPARASWPQAPAGWRIVASSRAGGWVTWRKA
Ga0187782_1109265023300017975Tropical PeatlandTGWPAGNPASADWPDHPAGWRIVAANQTAGWVAWRKS
Ga0187816_1011483723300017995Freshwater SedimentVVETEWLPGQSAQASWPQAPPGWRIVVSDQSAGWVAWRR
Ga0187816_1018053823300017995Freshwater SedimentAQPPPAGVNVVETGWPAGQAASAGWAVHPAGWRIVASNQAGGWVTWRKS
Ga0187815_1008297523300018001Freshwater SedimentVEFFNPAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRKS
Ga0187815_1025518223300018001Freshwater SedimentVEFFNPAQAPPAGTTVVETGWPAGQPASAGWPDHSAGWRIVASGQAAGWVAWRKS
Ga0187766_1079792613300018058Tropical PeatlandGQPASAGWPDHPAGWRIVASNQAAGWVAWRLAPGR
Ga0187774_1058828213300018089Tropical PeatlandTQPVPAGINVVEAGWPSGQPARASWTQAPAGWRIVAASQAGGWVTWRKA
Ga0210403_1127346923300020580SoilSQPLPPGTTVVEAAWPTGQPARAGWPQAPAGWRIVGSDQTAGWVVWRKG
Ga0210395_1055720713300020582SoilAPPAGVNVVETGWPAGQPASAGWPDHPAGWRIVAANQAAGWVAWRHSA
Ga0213876_1064850013300021384Plant RootsAGVSAVEMPWAGASAQASWPHAPAGWRVVASSQAGGWVLWQKS
Ga0210397_1069517523300021403SoilTVVETGWPTGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0210390_1109607323300021474SoilVVETGWPAGQPASAGWPNHPAGWRIVASSQAAGWVAWRNS
Ga0222756_106027113300022709SoilGGNVVETSWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS
Ga0207692_1036052423300025898Corn, Switchgrass And Miscanthus RhizosphereVVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA
Ga0207671_1111732613300025914Corn RhizosphereGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG
Ga0207671_1150452813300025914Corn RhizosphereVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG
Ga0207693_1021729413300025915Corn, Switchgrass And Miscanthus RhizosphereETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0207663_1168497823300025916Corn, Switchgrass And Miscanthus RhizosphereLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0207660_1103314823300025917Corn RhizosphereTVVETGWPAGQPAEAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0207700_1034744433300025928Corn, Switchgrass And Miscanthus RhizospherePAGTTVVETAWPTGQPATAGWPDSPAGWRIVASDQSADWVVWRKG
Ga0207664_1097213013300025929Agricultural SoilVGETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0207704_1035375023300025938Miscanthus RhizosphereGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG
Ga0207711_1140627323300025941Switchgrass RhizosphereGRQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG
Ga0207712_1159080523300025961Switchgrass RhizospherePGRQPLPAGTTVVETGWPSGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0209027_128706623300026300Grasslands SoilEAGWPTGQAATAGWSEAPAGWRIVASDQSAGWVVWRKG
Ga0208730_101229813300027047Forest SoilETGWPTGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS
Ga0208099_100240033300027096Forest SoilAGVNVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS
Ga0207826_101687633300027680Tropical Forest SoilRPVGQSARASWPQAPAGWRIVASGQVVASSQVGWVTWRKD
Ga0209693_1027845323300027855SoilELEFFDITQPVPAGVNVVEAGWPTGQSARTSWPRAPAGWHIVASSPSGGWVTWRKS
Ga0209380_1061998913300027889SoilETGWPAGQPASAGWPNHPAGWRIVAANQAAGWVAWRHA
Ga0268266_1169735513300028379Switchgrass RhizosphereRPGRQPVPAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG
Ga0311340_1123694713300029943PalsaEVSWTELEFFNLPGAPPAGTAVVETAWAAGQPAAASWPDTPAGWHIVAASQAAGWVAWRH
Ga0310037_1041679113300030494Peatlands SoilPPAGINVVETGWPAGQPAQASWPQAPTGWRIVASSRAGGWVVWRKA
Ga0307482_119851723300030730Hardwood Forest SoilLPAGTTVVETGWPAGQPAQATWPQAPAGWQIAAANHATGWVVWRKGLPADRSLKR
Ga0318534_1068339023300031544SoilPAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR
Ga0318528_1036206013300031561SoilAVVDTAWPAGQLAQASWPDAPAGWRIVAANRFGSWVVWRR
Ga0318555_1066093423300031640SoilAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQDAGWVVWRKG
Ga0318496_1079952513300031713SoilLEPFTSDGQPLPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQDAGWVVWRKG
Ga0306917_1098743213300031719SoilGTTVVESEWPAGQPAQAGWPEAPAGWRIVASDQAAGWVVWRQG
Ga0306918_1144263013300031744SoilPFTPGSQPVPAGTTVVESGWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRQG
Ga0318492_1016933213300031748SoilETGWPAGQPASSGWPNHPAGWRIVASNQAAGWVAWRKS
Ga0318494_1013362513300031751SoilGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR
Ga0307477_1068127523300031753Hardwood Forest SoilAPPAGVNVVETGWPAGQPASAGWPSHPAGWRIVASNQAAGWVAWRHS
Ga0318547_1070590033300031781SoilVEVPWTAGQAARASWPDAPAGWRIVGSDQAYAWVVWRKA
Ga0318523_1026776513300031798SoilAGTTVVESGWPTGQPARAGWPEAPAGWRIVASDQDAGWVIWRKG
Ga0318565_1066461413300031799SoilFNPASQPPPAGVTVVEVPWPAGQAARASWPDAPAGWRIVGSDQAYAWVVWRKA
Ga0318497_1010654313300031805SoilGPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA
Ga0318568_1034437013300031819SoilITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA
Ga0306919_1055026323300031879SoilVNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA
Ga0318522_1016129523300031894SoilQPVPAGTTVVESGWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRQG
Ga0318520_1015070323300031897SoilPPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR
Ga0306923_1081068813300031910SoilQAPPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR
Ga0306923_1112100513300031910SoilVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR
Ga0310916_1068393823300031942SoilGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR
Ga0310916_1159609213300031942SoilGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQADGWVTWRKA
Ga0310909_1066266413300031947SoilVNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA
Ga0306926_1173179123300031954SoilVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR
Ga0318569_1005394413300032010SoilITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQADGWVTWRKA
Ga0318513_1054139613300032065SoilAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR
Ga0318524_1020711823300032067SoilAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR
Ga0306924_1124275823300032076SoilAPPARVNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA
Ga0307471_10365966023300032180Hardwood Forest SoilPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG
Ga0307472_10055296913300032205Hardwood Forest SoilSRHPLPAGVNVVEAPWPTGQDAQASWPQAPAGWRIVASDQSAGWVVWRQG
Ga0306920_10307055323300032261SoilLEFFNPAQAPPAGTTVVETGWPAGQSPSSGWPNHPAGWHIVASNQAAGWVAWRKS
Ga0335085_1203133423300032770SoilGSQPPPAGTTVVESGWPTGQPAQAGWPGAPAGWRIVASDQNAGWVVWRKG
Ga0335070_1060563423300032829SoilFTPGQQPPPAGTTVVESGWPTGQPARAGWPDAPAGWRIVASDQSAGWVVWRKG
Ga0335083_1043136333300032954SoilADWPAGQPARASWPDAPAGWRIVAANRFGSWVVWRR
Ga0310914_1067803923300033289SoilGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA
Ga0318519_1018669013300033290SoilITQAPPGRVNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA
Ga0370515_0085602_3_1223300034163Untreated Peat SoilVETLWPNGQAASASWPHAPAGWRIVASNRSAGWVVWRHA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.