


| Basic Information | |
|---|---|
| Family ID | F076441 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.31 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.22 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.475 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (9.322 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.441 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (27.119 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00437 | T2SSE | 88.14 |
| PF00263 | Secretin | 2.54 |
| PF09940 | DUF2172 | 0.85 |
| PF01656 | CbiA | 0.85 |
| PF13629 | T2SS-T3SS_pil_N | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.47 % |
| All Organisms | root | All Organisms | 41.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502000|ACOD_F64RS5002I5UZX | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 501 | Open in IMG/M |
| 2140918013|NODE_178_length_1144_cov_8.841784 | Not Available | 1176 | Open in IMG/M |
| 2199352025|deepsgr__Contig_52981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 6048 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105223811 | Not Available | 612 | Open in IMG/M |
| 3300000574|JGI1357J11328_10180971 | Not Available | 578 | Open in IMG/M |
| 3300000955|JGI1027J12803_105321344 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300000956|JGI10216J12902_100848251 | Not Available | 865 | Open in IMG/M |
| 3300001431|F14TB_106206565 | Not Available | 546 | Open in IMG/M |
| 3300003890|Ga0063162_1094415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300003992|Ga0055470_10017704 | Not Available | 1279 | Open in IMG/M |
| 3300003993|Ga0055468_10146074 | Not Available | 701 | Open in IMG/M |
| 3300003994|Ga0055435_10144561 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300003997|Ga0055466_10178667 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300004058|Ga0055498_10125090 | Not Available | 543 | Open in IMG/M |
| 3300004463|Ga0063356_104815667 | Not Available | 580 | Open in IMG/M |
| 3300004808|Ga0062381_10038640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
| 3300005169|Ga0066810_10135507 | Not Available | 576 | Open in IMG/M |
| 3300005406|Ga0070703_10313290 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005445|Ga0070708_101697904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300005518|Ga0070699_101233278 | Not Available | 686 | Open in IMG/M |
| 3300005546|Ga0070696_100918682 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005718|Ga0068866_10757447 | Not Available | 671 | Open in IMG/M |
| 3300005764|Ga0066903_106674589 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005873|Ga0075287_1006704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1365 | Open in IMG/M |
| 3300006173|Ga0070716_100096800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1800 | Open in IMG/M |
| 3300006196|Ga0075422_10609891 | Not Available | 506 | Open in IMG/M |
| 3300006791|Ga0066653_10626522 | Not Available | 548 | Open in IMG/M |
| 3300006796|Ga0066665_11072893 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006865|Ga0073934_10463340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. P1XP2 | 765 | Open in IMG/M |
| 3300006881|Ga0068865_101591426 | Not Available | 587 | Open in IMG/M |
| 3300006914|Ga0075436_101545152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 504 | Open in IMG/M |
| 3300009081|Ga0105098_10738542 | Not Available | 526 | Open in IMG/M |
| 3300009098|Ga0105245_10919165 | Not Available | 917 | Open in IMG/M |
| 3300009147|Ga0114129_11725321 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009156|Ga0111538_13679300 | Not Available | 531 | Open in IMG/M |
| 3300009179|Ga0115028_10475775 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300010047|Ga0126382_11865756 | Not Available | 567 | Open in IMG/M |
| 3300010154|Ga0127503_10814550 | Not Available | 869 | Open in IMG/M |
| 3300010166|Ga0126306_11639030 | Not Available | 536 | Open in IMG/M |
| 3300010359|Ga0126376_11546626 | Not Available | 694 | Open in IMG/M |
| 3300010360|Ga0126372_12009535 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010362|Ga0126377_10090885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2763 | Open in IMG/M |
| 3300011412|Ga0137424_1097911 | Not Available | 598 | Open in IMG/M |
| 3300011429|Ga0137455_1102480 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012015|Ga0120187_1047800 | Not Available | 560 | Open in IMG/M |
| 3300012022|Ga0120191_10126988 | Not Available | 558 | Open in IMG/M |
| 3300012179|Ga0137334_1106941 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012211|Ga0137377_11245337 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012226|Ga0137447_1044361 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012355|Ga0137369_10427629 | Not Available | 949 | Open in IMG/M |
| 3300012356|Ga0137371_10384905 | Not Available | 1088 | Open in IMG/M |
| 3300012357|Ga0137384_10221966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1579 | Open in IMG/M |
| 3300012582|Ga0137358_10239365 | Not Available | 1236 | Open in IMG/M |
| 3300012676|Ga0137341_1063448 | Not Available | 618 | Open in IMG/M |
| 3300012976|Ga0134076_10439874 | Not Available | 587 | Open in IMG/M |
| 3300014321|Ga0075353_1152739 | Not Available | 584 | Open in IMG/M |
| 3300014324|Ga0075352_1273588 | Not Available | 528 | Open in IMG/M |
| 3300014883|Ga0180086_1070528 | Not Available | 862 | Open in IMG/M |
| 3300015374|Ga0132255_104118300 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300018028|Ga0184608_10268535 | Not Available | 751 | Open in IMG/M |
| 3300018031|Ga0184634_10368879 | Not Available | 658 | Open in IMG/M |
| 3300018059|Ga0184615_10558230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300018073|Ga0184624_10001814 | All Organisms → cellular organisms → Bacteria | 6138 | Open in IMG/M |
| 3300018084|Ga0184629_10385247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 737 | Open in IMG/M |
| 3300018469|Ga0190270_12859057 | Not Available | 545 | Open in IMG/M |
| 3300019208|Ga0180110_1255076 | Not Available | 511 | Open in IMG/M |
| 3300019232|Ga0180114_1237137 | Not Available | 504 | Open in IMG/M |
| 3300019259|Ga0184646_1510089 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1588 | Open in IMG/M |
| 3300020064|Ga0180107_1113314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1883 | Open in IMG/M |
| 3300020065|Ga0180113_1053957 | Not Available | 557 | Open in IMG/M |
| 3300021344|Ga0193719_10147832 | Not Available | 1015 | Open in IMG/M |
| 3300021560|Ga0126371_10078840 | All Organisms → cellular organisms → Bacteria | 3226 | Open in IMG/M |
| 3300022756|Ga0222622_10587385 | Not Available | 803 | Open in IMG/M |
| 3300025001|Ga0209618_1070790 | Not Available | 538 | Open in IMG/M |
| 3300025160|Ga0209109_10542617 | Not Available | 521 | Open in IMG/M |
| 3300025327|Ga0209751_10684627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 814 | Open in IMG/M |
| 3300025780|Ga0210100_1008732 | Not Available | 1167 | Open in IMG/M |
| 3300025796|Ga0210113_1038257 | Not Available | 972 | Open in IMG/M |
| 3300025885|Ga0207653_10236531 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025914|Ga0207671_11310962 | Not Available | 564 | Open in IMG/M |
| 3300025917|Ga0207660_10021099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4377 | Open in IMG/M |
| 3300025922|Ga0207646_10125476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2308 | Open in IMG/M |
| 3300025933|Ga0207706_10534301 | Not Available | 1010 | Open in IMG/M |
| 3300025934|Ga0207686_10479470 | Not Available | 962 | Open in IMG/M |
| 3300025935|Ga0207709_10291466 | Not Available | 1210 | Open in IMG/M |
| 3300025940|Ga0207691_11195050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300025986|Ga0207658_10600562 | Not Available | 989 | Open in IMG/M |
| 3300026005|Ga0208285_1018805 | Not Available | 562 | Open in IMG/M |
| 3300026045|Ga0208535_1004312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1454 | Open in IMG/M |
| 3300027614|Ga0209970_1022599 | Not Available | 1068 | Open in IMG/M |
| 3300027636|Ga0214469_1205661 | Not Available | 538 | Open in IMG/M |
| 3300027722|Ga0209819_10048677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1454 | Open in IMG/M |
| 3300027731|Ga0209592_1171022 | Not Available | 773 | Open in IMG/M |
| 3300027873|Ga0209814_10012317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3380 | Open in IMG/M |
| 3300027909|Ga0209382_12118287 | Not Available | 535 | Open in IMG/M |
| 3300028802|Ga0307503_10044764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1653 | Open in IMG/M |
| 3300030547|Ga0247656_1166552 | Not Available | 567 | Open in IMG/M |
| 3300030570|Ga0247647_1206342 | Not Available | 563 | Open in IMG/M |
| 3300031469|Ga0170819_14874646 | Not Available | 902 | Open in IMG/M |
| 3300031716|Ga0310813_11614018 | Not Available | 606 | Open in IMG/M |
| 3300031719|Ga0306917_10769014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin360 | 756 | Open in IMG/M |
| 3300031740|Ga0307468_101530449 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031847|Ga0310907_10147296 | Not Available | 1077 | Open in IMG/M |
| 3300031852|Ga0307410_10114993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1953 | Open in IMG/M |
| 3300031943|Ga0310885_10298602 | Not Available | 832 | Open in IMG/M |
| 3300031965|Ga0326597_11759932 | Not Available | 583 | Open in IMG/M |
| 3300032012|Ga0310902_10245689 | Not Available | 1075 | Open in IMG/M |
| 3300032180|Ga0307471_100067537 | All Organisms → cellular organisms → Bacteria | 3063 | Open in IMG/M |
| 3300032421|Ga0310812_10318434 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300033413|Ga0316603_11057514 | Not Available | 767 | Open in IMG/M |
| 3300034479|Ga0314785_001795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1197 | Open in IMG/M |
| 3300034661|Ga0314782_011076 | Not Available | 1379 | Open in IMG/M |
| 3300034661|Ga0314782_018399 | Not Available | 1161 | Open in IMG/M |
| 3300034663|Ga0314784_120086 | Not Available | 568 | Open in IMG/M |
| 3300034672|Ga0314797_014567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1167 | Open in IMG/M |
| 3300034672|Ga0314797_065465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 689 | Open in IMG/M |
| 3300034673|Ga0314798_061353 | Not Available | 727 | Open in IMG/M |
| 3300034675|Ga0314800_050088 | Not Available | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.32% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.08% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.54% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.85% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.85% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.85% |
| Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.85% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.85% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020064 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
| 3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030547 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034663 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODB_19902650 | 2040502000 | Fungus Garden | MSLLLIAIFSFLTAVSLIVILFMLPMAVQDTPQARIKRRLTSIGRLDQASR |
| Iowa-Corn-GraphCirc_01168000 | 2140918013 | Soil | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRR |
| deepsgr_00601080 | 2199352025 | Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQASRAEMQSIL |
| INPhiseqgaiiFebDRAFT_1052238111 | 3300000364 | Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQAS |
| JGI1357J11328_101809711 | 3300000574 | Groundwater | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNSPQARIKRRLTAIGRMDHASRAEIRSLLKT |
| JGI1027J12803_1053213443 | 3300000955 | Soil | MSLFLISLFSFFAILSLIVIVFMVPMAVQDSAQARIRRRLTAIGRMDAASRSEIQNLLKSSVYSD |
| JGI10216J12902_1008482511 | 3300000956 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQAR |
| F14TB_1062065652 | 3300001431 | Soil | MSILLIAVFSFLTALSLIVILFMLPMAVQDSPQARIKRRLTS |
| Ga0063162_10944151 | 3300003890 | Hot Spring Sediments | MSLLLIAVFSFLSAVSLVVILFMLPMAVQETPQARIKRRLTSIGRLQHASRAEIQNLLKTSV |
| Ga0055470_100177041 | 3300003992 | Natural And Restored Wetlands | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTI |
| Ga0055468_101460741 | 3300003993 | Natural And Restored Wetlands | MSLLVISIFAFLSAVSLIVILFMLPMAVQDTPQARIKRRLTTIG |
| Ga0055435_101445611 | 3300003994 | Natural And Restored Wetlands | MSLLVIVIFSFLAAVSLIVILFMLPMAVQDSAQARITRRLKAIGK |
| Ga0055466_101786671 | 3300003997 | Natural And Restored Wetlands | MSLLIISIFAFLSAVSLVVILFMLPMAVQDTAQARIKRRLTAIGRLDYASRA |
| Ga0055498_101250902 | 3300004058 | Natural And Restored Wetlands | MSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTAIGKL |
| Ga0063356_1048156671 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSLLLITVFSFLAAVSLVVILFLLPMAVQDTAQARIKRRL |
| Ga0062381_100386402 | 3300004808 | Wetland Sediment | MSLLLITIFAFLAAVSLVVILFLLPMAVQDTAQARIKRRLT |
| Ga0066810_101355071 | 3300005169 | Soil | MSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKA |
| Ga0070703_103132901 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGR |
| Ga0070708_1016979042 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRAE |
| Ga0070699_1012332782 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVLLITIFAFLSAVSLIVILFMLPMAVQDTPEARIKRRLTTIGRMDNATRAEVQS |
| Ga0070696_1009186822 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTT |
| Ga0068866_107574472 | 3300005718 | Miscanthus Rhizosphere | MSILLITLFSFLAAMSLIVILFILPMAVQDSPQARIKRR |
| Ga0066903_1066745892 | 3300005764 | Tropical Forest Soil | MNLLLIVLFSFLAAMTLIIVMFFVPMAVQNSPQARIKRRLTTVGR |
| Ga0075287_10067041 | 3300005873 | Rice Paddy Soil | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLD |
| Ga0070716_1000968003 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRS |
| Ga0075422_106098912 | 3300006196 | Populus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIG |
| Ga0066653_106265221 | 3300006791 | Soil | MNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRRLTAV |
| Ga0066665_110728931 | 3300006796 | Soil | MSLLLISLFSFLAAVSLIVILFLLPMAVQDTPQARIKRRLTTIGRLGQVSRADVQSI |
| Ga0073934_104633402 | 3300006865 | Hot Spring Sediment | MSLLLIAVFSFISAVALIVILFMLPMAVQDTPQARIKRRLTSIGRLQY |
| Ga0068865_1015914262 | 3300006881 | Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQTSRAEMATI |
| Ga0075436_1015451522 | 3300006914 | Populus Rhizosphere | MSLFLISLFSFFAILSLIVIIFMVPMAVQDSAQARIKRRLTAIGRMDAAS |
| Ga0105098_107385422 | 3300009081 | Freshwater Sediment | MNLLLIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTI |
| Ga0105245_109191651 | 3300009098 | Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLG |
| Ga0114129_117253211 | 3300009147 | Populus Rhizosphere | MSLFLIAIFVFLSAMSLIVIVFMLPLAVKDTAQARIKRRLTTIGHM |
| Ga0111538_136793001 | 3300009156 | Populus Rhizosphere | MSLLIIVLFSFLSAVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQS |
| Ga0115028_104757752 | 3300009179 | Wetland | MSLLLITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRL |
| Ga0126382_118657562 | 3300010047 | Tropical Forest Soil | MSLIVIVIFSFLAAMSLIVILFMLPMAVQDSAQARIKRRLTAIGKLDYASKSE |
| Ga0127503_108145502 | 3300010154 | Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIK |
| Ga0126306_116390301 | 3300010166 | Serpentine Soil | MSLFLIAIFVFLSAMSLIVMVFMLPMAVKDTAQARIRRRLTTIGHMTHASRSE |
| Ga0126376_115466261 | 3300010359 | Tropical Forest Soil | MNLLLIVLFSFLAALSLIIVMFFVPMAVQNSPQARIKR |
| Ga0126372_120095352 | 3300010360 | Tropical Forest Soil | MSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRAEIQN |
| Ga0126377_100908851 | 3300010362 | Tropical Forest Soil | MSLFLIALFSFFAILSLVVVIFMVPMAVQDTPQARIKRRLTAIGRMDTASRAEIQNLLKS |
| Ga0137424_10979112 | 3300011412 | Soil | MSLFLIAIFVFLAAVSLIVIMFMLPMAVKDTAQARIKRRLTTIGHMT |
| Ga0137455_11024801 | 3300011429 | Soil | MSLLLIVIFSFLAAVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQSL |
| Ga0120187_10478002 | 3300012015 | Terrestrial | MSLLLIAIFSFLSAVSLIVILFMLPMAVQDTPQARIKRRLTALRRLAYPSNAAGP |
| Ga0120191_101269881 | 3300012022 | Terrestrial | MNLLLIVLFSFLAAMTLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTS |
| Ga0137334_11069412 | 3300012179 | Soil | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDHASRAEI |
| Ga0137377_112453371 | 3300012211 | Vadose Zone Soil | MNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTSRADV |
| Ga0137447_10443611 | 3300012226 | Soil | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDHASRAE |
| Ga0137369_104276291 | 3300012355 | Vadose Zone Soil | MSLFLIAIFSFLSAVSLIVILFMLPMAVQDTPQARIKRRLTAIGRLDY |
| Ga0137371_103849052 | 3300012356 | Vadose Zone Soil | MNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRRLTAVGRLAS |
| Ga0137384_102219661 | 3300012357 | Vadose Zone Soil | MNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRR |
| Ga0137358_102393651 | 3300012582 | Vadose Zone Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQASRAE |
| Ga0137341_10634482 | 3300012676 | Soil | MNLLLIALFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTI |
| Ga0134076_104398741 | 3300012976 | Grasslands Soil | MNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVG |
| Ga0075353_11527392 | 3300014321 | Natural And Restored Wetlands | MSLFIIVIFSFLAAVSLIVILFMLPMAVQDSAQARI |
| Ga0075352_12735882 | 3300014324 | Natural And Restored Wetlands | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPHARIKRRLTAIGKMDNASRTEIQSLLKT |
| Ga0180086_10705282 | 3300014883 | Soil | MSILLITIFSFLAAMSLIVILFILPMAVQDSPQARIKRRLTAIR |
| Ga0132255_1041183002 | 3300015374 | Arabidopsis Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQAS |
| Ga0184608_102685352 | 3300018028 | Groundwater Sediment | MNLLLIVLFSFLAAMSLTIVMFFVPLAVQHSPQARSKRRLTPIGRAGNAS |
| Ga0184634_103688791 | 3300018031 | Groundwater Sediment | MSLLVIVIFSFLAAMSLIVILFMLPMAVKDTAQARIKRRLTAIGKLDYASKSEIQN |
| Ga0184615_105582301 | 3300018059 | Groundwater Sediment | MSLFVITIFSFLAAVSLIVICFMLPLAVQNTPQARIKRRLSAIGRMDYASRAEIQS |
| Ga0184624_100018141 | 3300018073 | Groundwater Sediment | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGR |
| Ga0184629_103852472 | 3300018084 | Groundwater Sediment | MSLLLIVIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLSAIGKLDYASKSDIQS |
| Ga0190270_128590571 | 3300018469 | Soil | MSLILITIFSFLAAVSLVVILFLLPMAVQDTAQAR |
| Ga0180110_12550762 | 3300019208 | Groundwater Sediment | MSILLITIFSFLAAMSLIVILFILPMAVQDSPQARIKRRLTA |
| Ga0180114_12371372 | 3300019232 | Groundwater Sediment | MSLLLIVIFSFLAAVSLIVILFMLPMAVQDTPQARIKKRLTAVGKLDYA |
| Ga0184646_15100891 | 3300019259 | Groundwater Sediment | MNILVIAIFSFLSALSLIVILFMLPMAVQDSPQARIKRRLTSIGRLDQASRA |
| Ga0180107_11133143 | 3300020064 | Groundwater Sediment | MNLLLIALFSFLAAMSLIIVMFFVPMAVQNSPQARIKRR |
| Ga0180113_10539572 | 3300020065 | Groundwater Sediment | MNILVIAIFSFLSALSLIVILFMLPMAVQDSPQARIKRRLTSIG |
| Ga0193719_101478321 | 3300021344 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTI |
| Ga0126371_100788401 | 3300021560 | Tropical Forest Soil | MSLFLIALFSFFAILSLVVVIFMVPMAVQDTPQARIKRRLTAIGRMDTASRAE |
| Ga0222622_105873852 | 3300022756 | Groundwater Sediment | MNLLLIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRL |
| Ga0209618_10707901 | 3300025001 | Soil | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRR |
| Ga0209109_105426172 | 3300025160 | Soil | MSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKKRLTAIGRMDYASRAEIQ |
| Ga0209751_106846272 | 3300025327 | Soil | MSLFIITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDYAS |
| Ga0210100_10087321 | 3300025780 | Natural And Restored Wetlands | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIG |
| Ga0210113_10382572 | 3300025796 | Natural And Restored Wetlands | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLDSATRAEVQS |
| Ga0207653_102365311 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQVSRA |
| Ga0207671_113109622 | 3300025914 | Corn Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKR |
| Ga0207660_100210991 | 3300025917 | Corn Rhizosphere | MSLFLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKR |
| Ga0207646_101254763 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRDR |
| Ga0207706_105343012 | 3300025933 | Corn Rhizosphere | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTI |
| Ga0207686_104794701 | 3300025934 | Miscanthus Rhizosphere | MGLFLIVLFSFLATMSLIVILFMLPMAVQDTPQARIR |
| Ga0207709_102914661 | 3300025935 | Miscanthus Rhizosphere | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLT |
| Ga0207691_111950501 | 3300025940 | Miscanthus Rhizosphere | MSILLITLFSFLAAMSLIVILFILPMAVQDSPQARIKR |
| Ga0207658_106005622 | 3300025986 | Switchgrass Rhizosphere | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRFDQASRA |
| Ga0208285_10188051 | 3300026005 | Rice Paddy Soil | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKR |
| Ga0208535_10043122 | 3300026045 | Natural And Restored Wetlands | MSLLVISIFAFLSAVSLIVILFMLPMAVQDTPQAR |
| Ga0209970_10225991 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLDSATRAEVQ |
| Ga0214469_12056611 | 3300027636 | Soil | MSLFLIAVFVFLAAMSLVVIIFMLPMAVQDTAQARIKRRLTTI |
| Ga0209819_100486772 | 3300027722 | Freshwater Sediment | MNLLLIALFSFLAAVSLIIVMFFVPMAVQSSPQARIKRRLT |
| Ga0209592_11710222 | 3300027731 | Freshwater Sediment | MSLILITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIGKLDYASK |
| Ga0209814_100123174 | 3300027873 | Populus Rhizosphere | MNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTSR |
| Ga0209382_121182871 | 3300027909 | Populus Rhizosphere | MSLFLIAIFVFLSAMSLIVILFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE |
| Ga0307503_100447643 | 3300028802 | Soil | MSLILISIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIGKLDY |
| Ga0247656_11665522 | 3300030547 | Soil | MSLFLIAIFVFLAAVSLIVIVFMLPMAVKDTAQARIKRRLTTIGHMTHASRSELQHLLKA |
| Ga0247647_12063422 | 3300030570 | Soil | MSLLIISIFAFLSAVSLIVILFVLPMAVQDSPQARIKRRLTTIGRLDRASRAEVQNILK |
| Ga0170819_148746461 | 3300031469 | Forest Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTT |
| Ga0310813_116140183 | 3300031716 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQA |
| Ga0306917_107690141 | 3300031719 | Soil | MSLLLISIFAFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQSSRAE |
| Ga0307468_1015304492 | 3300031740 | Hardwood Forest Soil | MSLLLIVIFAFLSMMSLIVIVFMLPMAVQDTPQARIRRRLSAIGRMDSASKA |
| Ga0310907_101472962 | 3300031847 | Soil | MSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTA |
| Ga0307410_101149933 | 3300031852 | Rhizosphere | MSLFLIAIFVFLSAMSLVVIIFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE |
| Ga0310885_102986021 | 3300031943 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQASRAEMATILKT |
| Ga0326597_117599322 | 3300031965 | Soil | MSLLVIVIFSFLAAMSLIVILFMLPMAVQDSAQARI |
| Ga0310902_102456892 | 3300032012 | Soil | MNLLLIVIFSFLAAMSLIIVIFFVPMAVQNSPQARIKRRLTTIGR |
| Ga0307471_1000675371 | 3300032180 | Hardwood Forest Soil | MNLLLIALFSFLALMSLIIVMFFVPMAVQNSPQARIK |
| Ga0310812_103184341 | 3300032421 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQVSRAEMA |
| Ga0316603_110575141 | 3300033413 | Soil | MSLLLITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIG |
| Ga0314785_001795_1039_1197 | 3300034479 | Soil | MSLFLIAIFVFLSAMSLIVIIFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE |
| Ga0314782_011076_3_173 | 3300034661 | Soil | MSLLLIVTFSFLASVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQSL |
| Ga0314782_018399_980_1159 | 3300034661 | Soil | MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRFDQASRAEMQSILKT |
| Ga0314784_120086_427_567 | 3300034663 | Soil | MSLLVISIFAFLSAVSLIVILFMLPMAVQDTPEARIKRRLTTIGRMD |
| Ga0314797_014567_1019_1165 | 3300034672 | Soil | MSLLLIAIFSFLAAVSLVVILFMLPMAVQDTALARIKRRLTAIGKLDYA |
| Ga0314797_065465_3_131 | 3300034672 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTI |
| Ga0314798_061353_612_725 | 3300034673 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKR |
| Ga0314800_050088_3_164 | 3300034675 | Soil | MNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQASRAEM |
| ⦗Top⦘ |