Metagenome / Metatranscriptome Family F076021

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F076021
Family Type	Metagenome / Metatranscriptome
Number of Sequences	118
Average Sequence Length	37 residues
Representative Sequence	VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Number of Associated Samples	97
Number of Associated Scaffolds	118

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	93.22 %
% of genes near scaffold ends (potentially truncated)	5.93 %
% of genes from short scaffolds (< 2000 bps)	76.27 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (55.085 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.102 % of family members)
Environment Ontology (ENVO)	Unclassified (52.542 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (61.017 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF14117	DUF4287	45.76
PF00173	Cyt-b5	11.02
PF00578	AhpC-TSA	8.47
PF00106	adh_short	4.24
PF11253	DUF3052	4.24
PF13527	Acetyltransf_9	2.54
PF10996	Beta-Casp	1.69
PF04229	GrpB	1.69
PF01523	PmbA_TldD	1.69
PF00005	ABC_tran	1.69
PF01061	ABC2_membrane	0.85
PF01557	FAA_hydrolase	0.85
PF02591	zf-RING_7	0.85
PF00528	BPD_transp_1	0.85
PF13456	RVT_3	0.85

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG0312	Zn-dependent protease PmbA/TldA or its inactivated homolog	General function prediction only [R]	1.69
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	1.69
COG1579	Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain	General function prediction only [R]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
All Organisms	root	All Organisms	44.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
cellular organisms	root	All Organisms → cellular organisms	44.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	44.92 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	36.44 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	31.36 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	16.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Candidatus Nanopelagicales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales	5.93 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	5.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Candidatus Nanopelagicaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae	5.93 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Candidatus Nanopelagicus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus	5.08 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
Candidatus Planktophila	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila	0.85 %
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.08 %
Candidatus Nanopelagicus abundans	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	5.08 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
Candidatus Planktophila	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila	0.85 %
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2236876005\|none_p091601	Not Available	502	Open in IMG/M
3300001282\|B570J14230_10129923	All Organisms → cellular organisms → Bacteria → Terrabacteria group	733	Open in IMG/M
3300001282\|B570J14230_10222701	Not Available	514	Open in IMG/M
3300001948\|GOS2228_1040726	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4765	Open in IMG/M
3300002161\|JGI24766J26685_10007656	All Organisms → cellular organisms → Bacteria	2976	Open in IMG/M
3300005517\|Ga0070374_10558445	All Organisms → cellular organisms → Bacteria → Terrabacteria group	569	Open in IMG/M
3300005517\|Ga0070374_10688244	Not Available	505	Open in IMG/M
3300005525\|Ga0068877_10315276	Not Available	901	Open in IMG/M
3300005525\|Ga0068877_10335575	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300005525\|Ga0068877_10483985	Not Available	686	Open in IMG/M
3300005525\|Ga0068877_10485130	Not Available	685	Open in IMG/M
3300005525\|Ga0068877_10566855	Not Available	620	Open in IMG/M
3300005527\|Ga0068876_10789024	Not Available	502	Open in IMG/M
3300005583\|Ga0049085_10300871	Not Available	521	Open in IMG/M
3300005585\|Ga0049084_10078983	Not Available	1202	Open in IMG/M
3300005585\|Ga0049084_10149981	Not Available	814	Open in IMG/M
3300005805\|Ga0079957_1042388	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2871	Open in IMG/M
3300005805\|Ga0079957_1048301	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2628	Open in IMG/M
3300006639\|Ga0079301_1012761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3082	Open in IMG/M
3300006639\|Ga0079301_1172192	Not Available	631	Open in IMG/M
3300007547\|Ga0102875_1144825	Not Available	748	Open in IMG/M
3300007585\|Ga0102916_1227305	Not Available	509	Open in IMG/M
3300007622\|Ga0102863_1057550	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	1136	Open in IMG/M
3300007630\|Ga0102903_1061974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	1043	Open in IMG/M
3300007639\|Ga0102865_1020607	All Organisms → cellular organisms → Bacteria	1884	Open in IMG/M
3300007644\|Ga0102902_1148228	Not Available	697	Open in IMG/M
3300008107\|Ga0114340_1212405	Not Available	634	Open in IMG/M
3300008108\|Ga0114341_10076689	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3420	Open in IMG/M
3300008108\|Ga0114341_10186147	Not Available	1173	Open in IMG/M
3300008108\|Ga0114341_10354879	Not Available	734	Open in IMG/M
3300008111\|Ga0114344_1053863	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	2445	Open in IMG/M
3300008114\|Ga0114347_1115795	Not Available	1011	Open in IMG/M
3300008117\|Ga0114351_1098782	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1706	Open in IMG/M
3300008117\|Ga0114351_1225976	Not Available	952	Open in IMG/M
3300008117\|Ga0114351_1377243	Not Available	619	Open in IMG/M
3300008262\|Ga0114337_1301039	Not Available	574	Open in IMG/M
3300008950\|Ga0102891_1024025	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	1935	Open in IMG/M
3300009050\|Ga0102909_1113233	Not Available	656	Open in IMG/M
3300010156\|Ga0068873_1008664	Not Available	1016	Open in IMG/M
3300010293\|Ga0116204_1186231	Not Available	678	Open in IMG/M
3300010368\|Ga0129324_10032482	Not Available	2484	Open in IMG/M
3300011268\|Ga0151620_1000094	All Organisms → cellular organisms → Bacteria	30393	Open in IMG/M
3300012970\|Ga0129338_1076985	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1112	Open in IMG/M
3300013004\|Ga0164293_10160978	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
(restricted) 3300013123\|Ga0172368_10117799	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1504	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10228456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1147	Open in IMG/M
(restricted) 3300013136\|Ga0172370_10188333	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1305	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10092883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2652	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10611963	Not Available	596	Open in IMG/M
3300014801\|Ga0119946_1005350	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1459	Open in IMG/M
3300019122\|Ga0188839_1001155	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4742	Open in IMG/M
3300020074\|Ga0194113_10007714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	13348	Open in IMG/M
3300020084\|Ga0194110_10669275	Not Available	647	Open in IMG/M
3300020159\|Ga0211734_10154610	Not Available	602	Open in IMG/M
3300020160\|Ga0211733_10374604	Not Available	1251	Open in IMG/M
3300020190\|Ga0194118_10504892	All Organisms → cellular organisms → Bacteria → Terrabacteria group	579	Open in IMG/M
3300020193\|Ga0194131_10012852	All Organisms → cellular organisms → Bacteria	9668	Open in IMG/M
3300020200\|Ga0194121_10358423	Not Available	729	Open in IMG/M
3300020494\|Ga0208326_103399	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1475	Open in IMG/M
3300020499\|Ga0208084_1002112	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3411	Open in IMG/M
3300020514\|Ga0208202_1011692	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1120	Open in IMG/M
3300020543\|Ga0208089_1019321	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	997	Open in IMG/M
3300020570\|Ga0208465_1000264	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	15981	Open in IMG/M
3300021091\|Ga0194133_10254292	Not Available	1108	Open in IMG/M
3300021959\|Ga0222716_10218330	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1196	Open in IMG/M
3300021961\|Ga0222714_10002765	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	18319	Open in IMG/M
3300021961\|Ga0222714_10092552	All Organisms → cellular organisms → Bacteria	1935	Open in IMG/M
3300021961\|Ga0222714_10127875	All Organisms → cellular organisms → Bacteria	1558	Open in IMG/M
3300021962\|Ga0222713_10061111	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2829	Open in IMG/M
3300021962\|Ga0222713_10090290	All Organisms → cellular organisms → Bacteria	2218	Open in IMG/M
3300021962\|Ga0222713_10713100	Not Available	570	Open in IMG/M
3300022556\|Ga0212121_10074251	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2682	Open in IMG/M
3300024239\|Ga0247724_1001330	Not Available	4841	Open in IMG/M
3300024276\|Ga0255205_1046400	Not Available	650	Open in IMG/M
3300024277\|Ga0255207_1004929	Not Available	2540	Open in IMG/M
3300024312\|Ga0255219_1013331	Not Available	1582	Open in IMG/M
3300024312\|Ga0255219_1035323	Not Available	842	Open in IMG/M
3300024346\|Ga0244775_10048353	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3713	Open in IMG/M
3300024348\|Ga0244776_10485331	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300024492\|Ga0255189_1048999	Not Available	555	Open in IMG/M
3300024512\|Ga0255186_1028712	Not Available	749	Open in IMG/M
3300024863\|Ga0255246_1022647	Not Available	1411	Open in IMG/M
3300025115\|Ga0209835_1018673	Not Available	2239	Open in IMG/M
3300026563\|Ga0256355_1104483	Not Available	502	Open in IMG/M
3300027205\|Ga0208926_1017621	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1074	Open in IMG/M
3300027211\|Ga0208307_1044547	Not Available	679	Open in IMG/M
3300027244\|Ga0208173_1028000	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1079	Open in IMG/M
3300027488\|Ga0255084_1009325	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	2000	Open in IMG/M
3300027499\|Ga0208788_1052204	Not Available	1087	Open in IMG/M
3300027499\|Ga0208788_1118402	Not Available	610	Open in IMG/M
3300027518\|Ga0208787_1135613	All Organisms → cellular organisms → Bacteria → Terrabacteria group	561	Open in IMG/M
3300027594\|Ga0255120_1023691	Not Available	1241	Open in IMG/M
3300027697\|Ga0209033_1042391	Not Available	1676	Open in IMG/M
3300027707\|Ga0209443_1029400	Not Available	2367	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1101584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1272	Open in IMG/M
3300027793\|Ga0209972_10438582	Not Available	547	Open in IMG/M
3300027804\|Ga0209358_10045080	Not Available	2632	Open in IMG/M
3300027806\|Ga0209985_10484681	Not Available	520	Open in IMG/M
(restricted) 3300028044\|Ga0247838_1083733	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1401	Open in IMG/M
3300028067\|Ga0255192_1027984	Not Available	843	Open in IMG/M
3300028086\|Ga0255201_1061539	Not Available	570	Open in IMG/M
(restricted) 3300028114\|Ga0247835_1200140	Not Available	682	Open in IMG/M
(restricted) 3300028559\|Ga0247831_1077924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1535	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10184943	Not Available	1196	Open in IMG/M
3300031758\|Ga0315907_10176962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila	1797	Open in IMG/M
3300031951\|Ga0315904_11122070	Not Available	611	Open in IMG/M
3300031951\|Ga0315904_11339582	Not Available	538	Open in IMG/M
3300032093\|Ga0315902_10807737	Not Available	739	Open in IMG/M
3300032116\|Ga0315903_10356578	Not Available	1209	Open in IMG/M
3300033979\|Ga0334978_0214111	Not Available	941	Open in IMG/M
3300033996\|Ga0334979_0003052	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12035	Open in IMG/M
3300034064\|Ga0335001_0084250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	1826	Open in IMG/M
3300034073\|Ga0310130_0053992	Not Available	1199	Open in IMG/M
3300034096\|Ga0335025_0087402	Not Available	1931	Open in IMG/M
3300034096\|Ga0335025_0138042	Not Available	1439	Open in IMG/M
3300034101\|Ga0335027_0174322	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1553	Open in IMG/M
3300034112\|Ga0335066_0228879	Not Available	1085	Open in IMG/M
3300034116\|Ga0335068_0066663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	2072	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.07%
Terrestrial	Environmental → Terrestrial	5.93%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	73.73%
Marine	Environmental → Aquatic → Marine	20.34%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.93%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	35.59%
Lentic	Environmental → Aquatic → Freshwater → Lentic	22.03%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	11.86%
River	Environmental → Aquatic → Freshwater → River	10.17%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.93%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.24%
Coastal	Environmental → Aquatic → Marine → Coastal	1.69%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.85%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	35.59%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	16.95%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	11.02%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	10.17%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.93%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	5.08%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.24%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.69%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	16.10%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.71%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	10.17%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	10.17%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	8.47%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	5.93%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	5.08%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.08%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.24%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	4.24%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.54%
Anoxic Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water	2.54%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.69%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.69%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.85%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.85%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.85%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.85%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.85%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.85%
Marine Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine	0.85%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.85%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.85%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2236876005	Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001948	Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007547	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02	Environmental	Open in IMG/M
3300007585	Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300007630	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02	Environmental	Open in IMG/M
3300007639	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02	Environmental	Open in IMG/M
3300007644	Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300008262	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA	Environmental	Open in IMG/M
3300008950	Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02	Environmental	Open in IMG/M
3300009050	Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02	Environmental	Open in IMG/M
3300010156	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG	Environmental	Open in IMG/M
3300010293	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012970	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013123 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013136 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m	Environmental	Open in IMG/M
3300013137 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300014801	Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW	Environmental	Open in IMG/M
3300019122	Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020084	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020190	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface	Environmental	Open in IMG/M
3300020193	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300020494	Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020499	Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020514	Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020543	Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020570	Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021091	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m	Environmental	Open in IMG/M
3300021959	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022556	Kivu_combined assembly	Environmental	Open in IMG/M
3300024239	Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E	Environmental	Open in IMG/M
3300024276	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d	Environmental	Open in IMG/M
3300024277	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d	Environmental	Open in IMG/M
3300024312	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8d	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024492	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h	Environmental	Open in IMG/M
3300024512	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h	Environmental	Open in IMG/M
3300024863	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025115	Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes)	Environmental	Open in IMG/M
3300026563	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027205	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)	Environmental	Open in IMG/M
3300027211	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes)	Environmental	Open in IMG/M
3300027244	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)	Environmental	Open in IMG/M
3300027488	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027518	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027594	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027730 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027806	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)	Environmental	Open in IMG/M
3300028044 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m	Environmental	Open in IMG/M
3300028067	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h	Environmental	Open in IMG/M
3300028086	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h	Environmental	Open in IMG/M
3300028114 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m	Environmental	Open in IMG/M
3300028559 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m	Environmental	Open in IMG/M
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
none_0916012	2236876005	Marine Estuarine	MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQGPAKK
B570J14230_101299232	3300001282	Freshwater	VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK*
B570J14230_102227012	3300001282	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK*
GOS2228_10407262	3300001948	Marine	MQAKISNALVAAQKVIAPAAVVILKAVVIELQGPAKK*
JGI24766J26685_100076562	3300002161	Freshwater And Sediment	VIQAKILNALVAARKAIAPAAAVSLKAAVIELQGLAKK*
Ga0070374_105584451	3300005517	Freshwater Lake	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK*
Ga0070374_106882442	3300005517	Freshwater Lake	MQAKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0068877_103152761	3300005525	Freshwater Lake	VIQAKILNALVAARKAIAPAAAVSLKAAVIELQDLAKK*
Ga0068877_103355752	3300005525	Freshwater Lake	VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK*
Ga0068877_104839851	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK*
Ga0068877_104851302	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVTLKVVVIELQDPAKK*
Ga0068877_105668551	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK*
Ga0068876_107890242	3300005527	Freshwater Lake	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK*
Ga0049085_103008712	3300005583	Freshwater Lentic	KISNALVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0049084_100789832	3300005585	Freshwater Lentic	VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK*
Ga0049084_101499812	3300005585	Freshwater Lentic	MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQDLAKK*
Ga0079957_10423881	3300005805	Lake	MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK*
Ga0079957_10483013	3300005805	Lake	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK*
Ga0079301_10127612	3300006639	Deep Subsurface	VMQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKKLWQ*
Ga0079301_11721922	3300006639	Deep Subsurface	MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK*
Ga0102875_11448252	3300007547	Estuarine	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK*
Ga0102916_12273052	3300007585	Estuarine	MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0102863_10575503	3300007622	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK*
Ga0102903_10619742	3300007630	Estuarine	VIQAKSLSVLADALKVIAPAAVVILKAAVIELQDLAKK*
Ga0102865_10206074	3300007639	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQDPAKK*
Ga0102902_11482282	3300007644	Estuarine	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQDLAKK*
Ga0114340_12124052	3300008107	Freshwater, Plankton	VIQAKILNALVVARKAIAPAAAVTLTVVVIELQDPAKK*
Ga0114341_100766893	3300008108	Freshwater, Plankton	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGLAKK*
Ga0114341_101861472	3300008108	Freshwater, Plankton	VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK*
Ga0114341_103548792	3300008108	Freshwater, Plankton	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGLAKK*
Ga0114344_10538632	3300008111	Freshwater, Plankton	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK*
Ga0114347_11157953	3300008114	Freshwater, Plankton	MQAKISNALVAAQKAIALAAVVILKVVVIELQDPAKK*
Ga0114351_10987822	3300008117	Freshwater, Plankton	VIQAKILNALVVARKAIAPAAAVILKAAVIELQDPAKK*
Ga0114351_12259763	3300008117	Freshwater, Plankton	MQAKISNALVAAQKVIALAAVVILKAVVIELQGPAKK*
Ga0114351_13772431	3300008117	Freshwater, Plankton	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQDLAKK*
Ga0114337_13010391	3300008262	Freshwater, Plankton	VIQAKILNALVAVQKVIAPAAVVSLKAAVIELQGLAKK*
Ga0102891_10240254	3300008950	Estuarine	MQAKISNALVAAQKVIAPAAAVILKAAVIELQGPAKK*
Ga0102909_11132332	3300009050	Estuarine	MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK*
Ga0068873_10086643	3300010156	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK*
Ga0116204_11862311	3300010293	Anoxic Lake Water	MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK*
Ga0129324_100324823	3300010368	Freshwater To Marine Saline Gradient	MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK*
Ga0151620_10000943	3300011268	Freshwater	VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK*
Ga0129338_10769851	3300012970	Aqueous	VIQAKILNALVVVRKVIAPAAAVILKAAVIELQGPAKK*
Ga0164293_101609785	3300013004	Freshwater	VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK*
(restricted) Ga0172368_101177993	3300013123	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDPAKK*
(restricted) Ga0172367_102284562	3300013126	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDHAKK*
(restricted) Ga0172370_101883332	3300013136	Freshwater	MQAKISNAPVAAQKVIAFAAVVILKAAVIELQDPAKK*
(restricted) Ga0172375_100928832	3300013137	Freshwater	MQAKISNAPVAAQKAIAPAAVVILKAVVIELQGPAKK*
(restricted) Ga0172376_106119631	3300014720	Freshwater	MQAKISNAPVAAQKVIEPAAVVILKAAVIELQDPAKK*
Ga0119946_10053502	3300014801	Aquatic	MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK*
Ga0188839_10011553	3300019122	Freshwater Lake	VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0194113_1000771412	3300020074	Freshwater Lake	MQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0194110_106692752	3300020084	Freshwater Lake	MQAKICNALVAAQKVIAPAAVVNLKAAVIELQDPAKK
Ga0211734_101546102	3300020159	Freshwater	VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0211733_103746042	3300020160	Freshwater	VVQAKISNALVAAQKLIALAAVVTRKVVAIGLQGPARK
Ga0194118_105048921	3300020190	Freshwater Lake	MQAKLSNAPVAAQKVIALSAVVILKAAVIELQDPAKK
Ga0194131_100128523	3300020193	Freshwater Lake	VMQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0194121_103584232	3300020200	Freshwater Lake	MQAKFSNAPVAAHKVIALAAVVILKAAVIELQDPAKK
Ga0208326_1033992	3300020494	Freshwater	VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0208084_10021123	3300020499	Freshwater	VIQSKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0208202_10116923	3300020514	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK
Ga0208089_10193211	3300020543	Freshwater	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGPAKK
Ga0208465_10002649	3300020570	Freshwater	VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0194133_102542922	3300021091	Freshwater Lake	MQAKICNALVAAQKVIAPAAVVNLKPAVIELQDPAKK
Ga0222716_102183302	3300021959	Estuarine Water	VIQAKSLNALVAVQKVAAPAAVVILKAAVIELQGLAKE
Ga0222714_100027656	3300021961	Estuarine Water	VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK
Ga0222714_100925522	3300021961	Estuarine Water	VIQAKISNAPVAARKVIAPAAVVILKAAVIELQGLAKK
Ga0222714_101278751	3300021961	Estuarine Water	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGPAKK
Ga0222713_100611116	3300021962	Estuarine Water	VIQAKISNALVVARKAFAPAAVVMLKAAVIELQGPAKK
Ga0222713_100902902	3300021962	Estuarine Water	VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK
Ga0222713_107131001	3300021962	Estuarine Water	MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK
Ga0212121_100742513	3300022556	Anoxic Lake Water	MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0247724_10013303	3300024239	Deep Subsurface Sediment	MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK
Ga0255205_10464002	3300024276	Freshwater	MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK
Ga0255207_10049292	3300024277	Freshwater	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK
Ga0255219_10133312	3300024312	Freshwater	VMQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK
Ga0255219_10353232	3300024312	Freshwater	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQGLAKK
Ga0244775_100483535	3300024346	Estuarine	VMQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK
Ga0244776_104853312	3300024348	Estuarine	MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK
Ga0255189_10489992	3300024492	Freshwater	VIQAKISNALVAARKVIAPAAAVSLKAAVIELQDLAKK
Ga0255186_10287121	3300024512	Freshwater	VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK
Ga0255246_10226474	3300024863	Freshwater	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209835_10186732	3300025115	Anoxic Lake Water	VMQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0256355_11044832	3300026563	Freshwater	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGPAKK
Ga0208926_10176213	3300027205	Estuarine	MQAKISNALVAAQKVAAPAAVVILKAAVIELQGLAKK
Ga0208307_10445472	3300027211	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK
Ga0208173_10280001	3300027244	Estuarine	AKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0255084_10093252	3300027488	Freshwater	MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0208788_10522043	3300027499	Deep Subsurface	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0208788_11184021	3300027499	Deep Subsurface	MQAKILNAPVAVQKVIALAAAVSLKAAVIELQGLAKK
Ga0208787_11356132	3300027518	Deep Subsurface	MQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKK
Ga0255120_10236914	3300027594	Freshwater	VMQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0209033_10423913	3300027697	Freshwater Lake	MQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209443_10294005	3300027707	Freshwater Lake	VMQAKISNALVAAQKVIAPAAAVILKAAVIELQDLAKK
(restricted) Ga0247833_11015842	3300027730	Freshwater	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0209972_104385822	3300027793	Freshwater Lake	VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK
Ga0209358_100450804	3300027804	Freshwater Lake	VMQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209985_104846812	3300027806	Freshwater Lake	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK
(restricted) Ga0247838_10837333	3300028044	Freshwater	VQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0255192_10279842	3300028067	Freshwater	VIQAKISNALVVARKAIAPAAAVTLKVVVIELQDPAKK
Ga0255201_10615391	3300028086	Freshwater	MQAKISNALVAAQKVIALAAAVSLKAAVIELQGLAKK
(restricted) Ga0247835_12001402	3300028114	Freshwater	MQAKISNALVATQKVIAPAAVVILKAAVIELQGLAKK
(restricted) Ga0247831_10779242	3300028559	Freshwater	MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK
(restricted) Ga0247840_101849432	3300028581	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0315907_101769622	3300031758	Freshwater	VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0315904_111220702	3300031951	Freshwater	VQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0315904_113395822	3300031951	Freshwater	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK
Ga0315902_108077372	3300032093	Freshwater	QAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK
Ga0315903_103565783	3300032116	Freshwater	VVQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0334978_0214111_784_894	3300033979	Freshwater	MGELSNALVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0334979_0003052_6038_6154	3300033996	Freshwater	MIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0335001_0084250_1720_1824	3300034064	Freshwater	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGPA
Ga0310130_0053992_4_117	3300034073	Fracking Water	MQAKILNAPVAVQKVIAPAAVVILKAAVIELQGLAKK
Ga0335025_0087402_1824_1931	3300034096	Freshwater	AKISNALVAAQKVIAPAAVVILKAAVIELQGPARK
Ga0335025_0138042_2_112	3300034096	Freshwater	MMQAKISNALVAAQKVIAPAAVVILKAAVIELQGPAR
Ga0335027_0174322_1405_1518	3300034101	Freshwater	MQAKSLNVLADALKVIAPAAVVILKAAVIELQGPAKK
Ga0335066_0228879_233_346	3300034112	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDPAKK
Ga0335068_0066663_250_363	3300034116	Freshwater	MQAKISNALVAAQKVIAPAALVILKAAVIELQGAAKK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters