NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075328

Metagenome / Metatranscriptome Family F075328

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075328
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 59 residues
Representative Sequence MKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIYFVDLPKE
Number of Associated Samples 105
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 51.26 %
% of genes near scaffold ends (potentially truncated) 20.17 %
% of genes from short scaffolds (< 2000 bps) 98.32 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.076 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(21.008 % of family members)
Environment Ontology (ENVO) Unclassified
(56.303 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.790 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 31.25%    Coil/Unstructured: 68.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00400WD40 10.92
PF12894ANAPC4_WD40 2.52
PF09668Asp_protease 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.08 %
UnclassifiedrootN/A10.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10082662All Organisms → cellular organisms → Eukaryota1191Open in IMG/M
3300001355|JGI20158J14315_10066201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1407Open in IMG/M
3300001953|GOS2231_1013853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1628Open in IMG/M
3300003621|JGI26083J51738_10129931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii524Open in IMG/M
3300003909|JGI26087J52781_1006718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1404Open in IMG/M
3300004095|Ga0007829_10035447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300004767|Ga0007750_1207257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300005516|Ga0066831_10002226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum5303Open in IMG/M
3300005662|Ga0078894_10512654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1076Open in IMG/M
3300005941|Ga0070743_10063781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1250Open in IMG/M
3300006165|Ga0075443_10040028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1569Open in IMG/M
3300006641|Ga0075471_10439500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii651Open in IMG/M
3300006803|Ga0075467_10146385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1360Open in IMG/M
3300006803|Ga0075467_10150438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1337Open in IMG/M
3300007202|Ga0103274_1092928All Organisms → cellular organisms → Eukaryota1290Open in IMG/M
3300007513|Ga0105019_1085093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1759Open in IMG/M
3300007513|Ga0105019_1091660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1674Open in IMG/M
3300007554|Ga0102820_1040518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1135Open in IMG/M
3300007956|Ga0105741_1171434Not Available533Open in IMG/M
3300007957|Ga0105742_1065910Not Available534Open in IMG/M
3300008113|Ga0114346_1258770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300008119|Ga0114354_1080408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1330Open in IMG/M
3300009071|Ga0115566_10288829All Organisms → cellular organisms → Eukaryota970Open in IMG/M
3300009172|Ga0114995_10093780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1686Open in IMG/M
3300009172|Ga0114995_10105907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1577Open in IMG/M
3300009193|Ga0115551_1126002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1186Open in IMG/M
3300009263|Ga0103872_1004234All Organisms → cellular organisms → Eukaryota1148Open in IMG/M
3300009265|Ga0103873_1001737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1852Open in IMG/M
3300009265|Ga0103873_1005673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1476Open in IMG/M
3300009432|Ga0115005_10225599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1464Open in IMG/M
3300009434|Ga0115562_1121104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1007Open in IMG/M
3300009434|Ga0115562_1225108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300009436|Ga0115008_10151844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1685Open in IMG/M
3300009436|Ga0115008_10206523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1407Open in IMG/M
3300009436|Ga0115008_10702910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300009436|Ga0115008_11119476Not Available593Open in IMG/M
3300009441|Ga0115007_10206827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1266Open in IMG/M
3300009442|Ga0115563_1240240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida679Open in IMG/M
3300009442|Ga0115563_1377948Not Available505Open in IMG/M
3300009592|Ga0115101_1001817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1387Open in IMG/M
3300009705|Ga0115000_10456049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300009785|Ga0115001_10831094Not Available556Open in IMG/M
3300010354|Ga0129333_11447257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii564Open in IMG/M
3300010370|Ga0129336_10413439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii735Open in IMG/M
3300010883|Ga0133547_10569711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2271Open in IMG/M
3300010970|Ga0137575_10078391Not Available526Open in IMG/M
3300012036|Ga0136600_1026875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1422Open in IMG/M
3300012954|Ga0163111_11119645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300013014|Ga0164295_10899107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300016703|Ga0182088_1171671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300016882|Ga0186577_103222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1320Open in IMG/M
3300017717|Ga0181404_1158106Not Available546Open in IMG/M
3300017735|Ga0181431_1091525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii682Open in IMG/M
3300017746|Ga0181389_1209925Not Available501Open in IMG/M
3300017770|Ga0187217_1052591All Organisms → cellular organisms → Eukaryota1417Open in IMG/M
3300017772|Ga0181430_1220885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300017951|Ga0181577_10450375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300018420|Ga0181563_10157819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1420Open in IMG/M
3300018426|Ga0181566_10807247Not Available640Open in IMG/M
3300018628|Ga0193355_1002997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1261Open in IMG/M
3300018692|Ga0192944_1038559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300018742|Ga0193138_1046092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300018766|Ga0193181_1032972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii748Open in IMG/M
3300018846|Ga0193253_1025087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1401Open in IMG/M
3300018980|Ga0192961_10033645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1394Open in IMG/M
3300019031|Ga0193516_10110634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum935Open in IMG/M
3300019050|Ga0192966_10115505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum934Open in IMG/M
3300020205|Ga0211731_11634579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1481Open in IMG/M
3300020382|Ga0211686_10154271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii947Open in IMG/M
3300020513|Ga0208090_1011127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1423Open in IMG/M
3300021169|Ga0206687_1589662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1420Open in IMG/M
3300021336|Ga0210307_1053007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1510Open in IMG/M
3300021342|Ga0206691_1699232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1284Open in IMG/M
3300021348|Ga0206695_1426109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300021912|Ga0063133_1049940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1161Open in IMG/M
3300021934|Ga0063139_1076128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300021962|Ga0222713_10186384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1400Open in IMG/M
3300021962|Ga0222713_10319295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum982Open in IMG/M
(restricted) 3300024261|Ga0233439_10250200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii784Open in IMG/M
3300024346|Ga0244775_10353609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1212Open in IMG/M
3300025680|Ga0209306_1103789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300025699|Ga0209715_1183232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300025849|Ga0209603_1317954Not Available537Open in IMG/M
3300025879|Ga0209555_10228567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300025890|Ga0209631_10099682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1678Open in IMG/M
3300025897|Ga0209425_10163755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1225Open in IMG/M
3300026448|Ga0247594_1011403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1382Open in IMG/M
3300027416|Ga0207994_1037691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida982Open in IMG/M
3300027687|Ga0209710_1171701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii766Open in IMG/M
3300027751|Ga0208304_10101126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1084Open in IMG/M
3300027760|Ga0209598_10402813Not Available500Open in IMG/M
3300027771|Ga0209279_10039466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1360Open in IMG/M
3300027771|Ga0209279_10228580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300027791|Ga0209830_10496192Not Available501Open in IMG/M
3300027810|Ga0209302_10436748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii587Open in IMG/M
3300027833|Ga0209092_10387606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300027833|Ga0209092_10449927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300027849|Ga0209712_10120482All Organisms → cellular organisms → Eukaryota1507Open in IMG/M
3300028134|Ga0256411_1051376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1404Open in IMG/M
3300028282|Ga0256413_1072123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1230Open in IMG/M
3300028282|Ga0256413_1244292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300028282|Ga0256413_1245878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300030670|Ga0307401_10495341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300030788|Ga0073964_11632637Not Available721Open in IMG/M
3300031216|Ga0307980_1073386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii711Open in IMG/M
3300031522|Ga0307388_11030276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300031569|Ga0307489_10223787All Organisms → cellular organisms → Eukaryota1179Open in IMG/M
3300031602|Ga0307993_1087990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300031729|Ga0307391_10322012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum845Open in IMG/M
3300031737|Ga0307387_10885141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii566Open in IMG/M
3300032047|Ga0315330_10393180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii856Open in IMG/M
3300032463|Ga0314684_10143383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1268Open in IMG/M
3300032519|Ga0314676_10693165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300032520|Ga0314667_10421888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300032540|Ga0314682_10621526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300032730|Ga0314699_10401330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300032747|Ga0314712_10521145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300032748|Ga0314713_10327276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300034022|Ga0335005_0177777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1334Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.01%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.88%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.20%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.20%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.36%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.36%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.36%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.52%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.52%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.52%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.52%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.68%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.68%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.84%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.84%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.84%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.84%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.84%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.84%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.84%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.84%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001953Marine microbial communities from Key West, Florida, USA - GS015EnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020513Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1008266213300001354Pelagic MarineMKVLNKYWDSDLCLSKIKVNEKFKSVGFDIKNNRLAIITNDRTMYFVDLPKEQ*
JGI20158J14315_1006620143300001355Pelagic MarineLQFLKVVNKFWDGDLCLSKVKVNEKLKTIGFDIKNDRLTIVTHDRTIYFVDIPTEQCRYIDQVEVRFY*
GOS2231_101385343300001953MarineMKVLNKYWDSDLCLSKIKVNEKFKAIGFDVKNNRLAIVTNERTIYFVDLPKEQTRYIEEAEVRFY*
JGI26083J51738_1012993113300003621MarineMEVNNNKSGLQFMKVLNKYWDSDLCLSKIKVNEKMKQVGFDTKNNRLTIVTYDRVIYFVDLPKDQCRYIEKAECRFY*
JGI26087J52781_100671813300003909MarineMKVLNKYWDSDLCLTKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKEQTRYIEEAECRF
Ga0007829_1003544733300004095FreshwaterMKVINKYWDSELCLTKIKINEKEKQIGFDAKNGRLAIVTFDRKIYFVDIP*
Ga0007750_120725723300004767Freshwater LakeLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTIYFV
Ga0066831_1000222633300005516MarineLEVFDLYCNYSAQFLKVLNKYWDSDLCLTKIKVNEKLKTIGFDVKNGRLTIVTHDRVIYFVDIPKE*
Ga0078894_1051265413300005662Freshwater LakeLFRLSVVKFLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTI
Ga0070743_1006378133300005941EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSLGFDQKNRRLTIVTYDRVIYFVDLPD*
Ga0075443_1004002833300006165MarineMKVLNKYFDSDLCLTKIKVNEKMKTIGFDVKNHRLAIVTHDRTIYFVDIPKEQARYIEEAECRFY*
Ga0075471_1043950013300006641AqueousMKVINKYWDSELCLTKIKVMENFKTVGFDQKNRRISIITHDRTIYFVDLPEQ*
Ga0075467_1014638513300006803AqueousMKVINKYWDSDLCLTKIKISEKCKTIGFDQKNRRMTIVTHDRSIYFVDLPSEQTRYIEKAEVRFF*
Ga0075467_1015043833300006803AqueousMKVLNKYWDSDLCLTKIKVGEKCKTLGFDSKNRRLSIITYDRSIFFVDLPDQQSRYIEQAEVRFF*
Ga0103274_109292813300007202Freshwater LakeMKVINKYWDSELCLTKIKINEKEKQIGFDAKNGRLAIVTYDRKIYFVDIP*
Ga0105019_108509333300007513MarineMGFLKVLNKYWDSDMCMAKIKVNEKLKTIGFDAKNNKLTIVTHDRTIYFVELPKE*
Ga0105019_109166023300007513MarineMKVINKYFDSDLCLSKIKVNERMKSIGFDVKNNRLTIVTHDRVLYFADIPKEQKRYIDEAECRFY*
Ga0102820_104051843300007554EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKEQTRYIEEAECRFY*
Ga0105741_117143423300007956Estuary WaterMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYLDEAECRFY*
Ga0105742_106591013300007957Estuary WaterSDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYLDEAECRFY*
Ga0114346_125877013300008113Freshwater, PlanktonMTYLFRLSVVKFLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTIYFVDIP
Ga0114354_108040833300008119Freshwater, PlanktonMKVINKYWESELCLTKIKINEKFKQIGFDSKNKRLAIVTYDRSIYFVNLPEEQSRYIEEAEVRF
Ga0115566_1028882913300009071Pelagic MarineMKVINKYWDSDLCLSKIKVNEKFKSIGFDAKNNRLSIVTHDRTIYFVDLPKE*
Ga0114995_1009378013300009172MarineMKVLNKSWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIYFVDLPKE*
Ga0114995_1010590713300009172MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRTIYFVDLPKEQVRYIE*
Ga0115551_112600233300009193Pelagic MarineMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYLDEAECRFY*PISIRAI*CQKLNE*
Ga0103872_100423413300009263Surface Ocean WaterMKVLNKYWDTDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQTRYIEQAECRFY*
Ga0103873_100173713300009265Surface Ocean WaterMKVLNKYWDSDLCLSKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKE*
Ga0103873_100567313300009265Surface Ocean WaterMKVLNKYWDTDLCLTKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQTRYIEQAECRFY*
Ga0115005_1022559913300009432MarineMCRLQFLKVINKFFDHDLCLSKIKVNEKLKTIGFDVKNNRLSIVTHDRTIYFVDLPESQ*
Ga0115562_112110433300009434Pelagic MarineMKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIYFVDLPKE*
Ga0115562_122510813300009434Pelagic MarineMTIIFYRLGFMKVLNKYWDSDLCLTKIKVNEKFKAIGFDIKNNRLTIVTNERTIYFVDLPKD*
Ga0115008_1015184413300009436MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIYFVDLPKE*
Ga0115008_1020652343300009436MarineMNMLKVVNKFFDHDLCLTKIKVSEKLKTIGFDVKNNRLSIVTHDRTIYFVNLPETQQRYID*
Ga0115008_1070291023300009436MarineMKVLNKYWESDLCLTKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVELPKEQSRYIEEAECRFY*
Ga0115008_1111947623300009436MarineMGFLKVLNKYWDSDMCMAKIKVNEKLKTIGFDVKNNKLTIVTHDRSIYFVDLPKEQIRHIPSCEVRFY*
Ga0115007_1020682713300009441MarineMGFLKVLNKYWDSDMCMAKIKVNEKTKTIGFDVKNNKLTIVTHDRTIYFVDLPTS*
Ga0115563_124024013300009442Pelagic MarineMKVLNKYWDSDLCLSKIKVNEKFKQIGFDVKNNRLAIVTNERSLYFVDLPKE*
Ga0115563_137794823300009442Pelagic MarineLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYLDEAECRFY*
Ga0115101_100181713300009592MarineMKVLNKYFDSDLCLTKIKVNEKLKTIGFDVKNHRLAIVTHDRTIYFVDIPKDQVRYIEEAECRFY*
Ga0115000_1045604923300009705MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIYFIDLPKEQVRYIEEAEVRFY*
Ga0115001_1083109413300009785MarineSLQFMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKE*
Ga0129333_1144725713300010354Freshwater To Marine Saline GradientMKVLNKYWDSDLCLSKIKVNEKMKQIGFDFKNGRLAIVTFDRTIYFVDIPKDQTRYLDEAEVRFY*
Ga0129336_1041343913300010370Freshwater To Marine Saline GradientMKVLNKYWDSDLCLTKIKVNEKFKSLGFDQKNRRLTIVTYDRAIYFVDLPD*
Ga0133547_1056971143300010883MarineMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKE*
Ga0137575_1007839113300010970Pond Fresh WaterLFRLSVVKFLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTIYFVDIPKE*
Ga0136600_102687533300012036Saline LakeMKVINKFWDSDLCLTKVKVNEQFKALGFDQKNRRLTIVTHDRNIYFIDLPDTQSRYVETAEVRFF*
Ga0163111_1111964523300012954Surface SeawaterMFNNVDIFIMYRLGFMKVLNKYWDSDLCLTKIKVNEKFKAIGFDVKNNRLTIVTNERTIYFVDLPKDQTRYIEEAECRFY*
Ga0164295_1089910713300013014FreshwaterMTYLFRLSVVKFLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTIYFVDIPKE*
Ga0182088_117167113300016703Salt MarshMKVLNKYWDSDLCLSKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKEQTRYIEEAECRFY
Ga0186577_10322213300016882Host-AssociatedMKVLNKYWDSDLCLTKIKINEKMKTVGFDTKNNRLSIVTYDRTIYFVDIPKEQTRYIESTECRFY
Ga0181404_115810613300017717SeawaterMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKE
Ga0181431_109152523300017735SeawaterMKVFNKYWDSDMCMAKIKVNEKMKVIGFDVKNEKLTIVTHDRTIYFVDLPSEQIRHIAQCEVRFY
Ga0181389_120992513300017746SeawaterMKVLNKYWDSDLCLSKIKLECDMKTVGFDAKNGRMSIVTNDRCIYFVDIPAESTRYIE
Ga0187217_105259133300017770SeawaterMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRY
Ga0181430_122088513300017772SeawaterMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQIRYI
Ga0181577_1045037523300017951Salt MarshMKVINKYWDSDLCLSKIKINEPMKTIGFDAKNNRLSIVTHDRTIYFVDLPKEQQRYIEEAELRCF
Ga0181563_1015781943300018420Salt MarshMKVINKYWDSDLCLSKIKVNEKFKSIGFDAKNNRLSIVTHDRTIYFVDLPKE
Ga0181566_1080724723300018426Salt MarshMHRFSFMKVVNKYWDSELCLTKVKIKEGAKTIGFDSKNNRLAIVTYDR
Ga0193355_100299713300018628MarineMKVLNKYWDSDLCLTKIKLDDPTKVVAFDSKKNKLAIITYDRTIYFVDVPPE
Ga0192944_103855923300018692MarineMKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIYFVDLPKE
Ga0193138_104609223300018742MarineMGIFNKYWDSDLCLAKVKVNEKFKSIGFDVKNNRLAIVTNERSLYFVDLPKDQTRYIEEAECRFY
Ga0193181_103297223300018766MarineMKVLNKYWESDLCLTKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDIPKEQQRYIEEAECRFY
Ga0193253_102508713300018846MarineMKVLNKYFDSDLCLTKIKVNEKLKTIGFDVKNHRLAIVTHDRTIYFVDIPKDQVRYIEEAECRFY
Ga0192961_1003364533300018980MarineMKVLNKYFDSDLCLTKIKVNEKLKTIGFDVKNHRLAIVTHDRTIYFVDIPKDQLRYIEEAECRFY
Ga0193516_1011063423300019031MarineMKVINKYFDSDLCLSKIKVNERMKSIGFDVKNNRLTIVTHDRVLYFAEIPKEQKRYIDEAECRFY
Ga0192966_1011550513300019050MarineMKVLNKYWDSDLCLSKIKVNEKFKTCAFDVKNNRLAIVTNDRTIYFIDLPKE
Ga0211731_1163457923300020205FreshwaterMKVINKYWESELCLTKIKINEKFKQIGFDSKNKRLAIVTYDRSIYFVNLPEEQSRYIEEAEVRFY
Ga0211686_1015427123300020382MarineMKVLNKYWESDLCLTKIKVNEKFKTIGFDFKNNRMAIVTHDRTIYFVDIPKEQQRYIEEAECRFY
Ga0208090_101112713300020513FreshwaterMTYLFRLSVVKFLNKYFDHDLCLTKIKINEKIKQIGFDSKNGRMAIVTTDRTIYFVDIPK
Ga0206687_158966233300021169SeawaterMKVLNKYWDSDLCLSKIKVNEKFKQIGFDSKNNRLTIVTHDRTLYFIDIPKEQVRYVN
Ga0210307_105300733300021336EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKEQTRYIEEAECRFY
Ga0206691_169923243300021342SeawaterMKVINKYWDSDLCLSKVKVNEKLKTIGFDVKNDRLTIVTHDRTIYFVDLP
Ga0206695_142610913300021348SeawaterMPFLKVLNKYWDSDMCMAKIKVNEKLKTIGFDVKNNKLTIVTHDRTIYFVDLPATQVRHI
Ga0063133_104994023300021912MarineMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRMAIVTHDRTIYFVDLPKE
Ga0063139_107612823300021934MarineMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYIEEAECRFY
Ga0222713_1018638443300021962Estuarine WaterMKVVNKYWDSDLCLTKIKVNEKYKTVGFDQKNRRMAIVTHDRTIYFVDLPDS
Ga0222713_1031929523300021962Estuarine WaterMKVLNKYFDSDLCLTKIKVNDKFKSIGFDAKNNKLAIVTHDRTIYFVEIPKE
(restricted) Ga0233439_1025020013300024261SeawaterMKVINKYWDSDLCLSKIKVNEKLKTIGFDVKNERLTIVTHDRTIYFVDLPQEQCRYIE
Ga0244775_1035360933300024346EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSLGFDQKNRRLTIVTYDRVI
Ga0209306_110378913300025680Pelagic MarineMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQVRYLDEAECRFY
Ga0209715_118323223300025699Pelagic MarineMKVLNKYWESDLCLAKIKVNEKSKTIGFDFKNNRLAIVTHDRTIYFVD
Ga0209603_131795413300025849Pelagic MarineMTIIFYRLGFMKVLNKYWDSDLCLTKIKVNEKFKAIGFDIKNNRLTIVTNERTIYFVDLPKD
Ga0209555_1022856713300025879MarineMEVNNNKSGLQFMKVLNKYWDSDLCLSKIKVNEKMKQVGFDTKNNRLTIVTYDRVIYFVDLPKDQCRYIEKAECRFY
Ga0209631_1009968213300025890Pelagic MarineMKVLNKYWDSDLCLTKIKVNEKFKSIGFDVKNNRLAIVTNDRSIYFVDLPKEQ
Ga0209425_1016375533300025897Pelagic MarineMKVLNKYWDSDLCLTKIKVNEKFKAIGFDTKNNRLTIVTNERTIYFVDLPKD
Ga0247594_101140333300026448SeawaterMKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIYFVDLPKEQTRYIEEAECRFY
Ga0207994_103769133300027416EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSIGFDAKNNRLAIVTHDRTIYFVDIPKEQTRYI
Ga0209710_117170113300027687MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRTIYFVDLPKEQVRYIE
Ga0208304_1010112613300027751EstuarineMKVLNKYWDSDLCLTKIKVNEKFKSLGFDQKNRRLTIVTYDRVIYFVDLPD
Ga0209598_1040281323300027760Freshwater LakeMKVINKYWDSELCLTKIKINEKEKQIGFDAKNGRLAIVTFDRKIYFVDIP
Ga0209279_1003946613300027771MarineMKVLNKYFDSDLCLTKIKVNEKMKTIGFDVKNHRLAIVTHDRTIYFVDIPKEQARYIEEAECRFY
Ga0209279_1022858023300027771MarineMKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIYFVDLPK
Ga0209830_1049619213300027791MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIYFIDLPKEQVRYIEEAEVRFY
Ga0209302_1043674823300027810MarineMLKVVNKFFDHDLCLTKIKVSEKLKTIGFDVKNNRLSIVTHDRTIYFVNLPETQQRYID
Ga0209092_1038760613300027833MarineMKVLNKYWESDLCLTKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVELPKEQSRYIEEAECRFY
Ga0209092_1044992713300027833MarineMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIYFVDLPKE
Ga0209712_1012048213300027849MarineMLKVVNKFFDHDLCLSKIKVNEKLKTIGFDVKNNRLSIVTHDRTIYFVDLPDS
Ga0256411_105137643300028134SeawaterMKVLNKYWESDLCLTKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDIPKEQSRYIEEAECRFY
Ga0256413_107212343300028282SeawaterMKVLNKYWESDLCLTKIKVNEKMKNNRLAIVTHDRTIYFVDIPKEQ
Ga0256413_124429223300028282SeawaterMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQIRYIEEAECRFY
Ga0256413_124587823300028282SeawaterMKVVNKYWDSDLCLSKIKVNEDKKTIGFDIKNNRLAIVTNDRTIYFVDLPKEQARYIEEAEVRFY
Ga0307401_1049534113300030670MarineMKVLNKYWESDMCLSKVKVNEDKKTIGFDIKNDRLAIVTYDRSIYFVELPKE
Ga0073964_1163263713300030788MarineMSVVNKYFDSDLCLTKIKLDAPSKTIGFDAQSNKLAIVTYDRQIFYAEIP
Ga0307980_107338613300031216Saline WaterMKVINKFWDSDLCLTKVKVNEQFKALGFDQKNRRLTIVTHDRNIYFIDLPDTQSRYVETAEVRFF
Ga0307388_1103027613300031522MarineMKVLNKYWESDMCLSKIKVNEDKKTIGFDIKNDRLAIVTYDRSIYFVELPKE
Ga0307489_1022378733300031569Sackhole BrineMTHYYHRLTFMKVLNKYWDSDLCLTKIKINEKFKSIGFDTKNNRLAIVTHDRTIYFVDIPKE
Ga0307993_108799013300031602MarineMKVLNKYWESDMCLSKVKVNEDKKTIGFDIKNDRLAIVTHDRSIYFCELPKEQVRYIEEVEVRFY
Ga0307391_1032201223300031729MarineMKVLNKYWESDMCLSKVKVNEDKKTIGFDIKNDRLAIVTHDRSIYFCELPKEQVRYIEEVEV
Ga0307387_1088514113300031737MarineMKVFNKYWDSDMCMAKIKVNEKLKTIGFDVKNEKLTIVTHDRTIYFVDLPSE
Ga0315330_1039318023300032047SeawaterMTFGFDLSYIFSLQFMKVLNKYWESDLCLAKIKVNEKMKTIGFDFKNNRLAIVTHDRTIYFVDLPKEQARYIEEAECRFY
Ga0314684_1014338313300032463SeawaterMKVLNKYWDSDLCLSKIKVNEKFKSVGFDVKNDRLAIITNERTMYFIDLPKEQQRYVEEAECRFY
Ga0314676_1069316523300032519SeawaterMKVLNKYWDSDLCLSKIKVNEKFKPIGFDVKNNRLAIVTNDRTIYFVDL
Ga0314667_1042188823300032520SeawaterMFIIYSLQFMKVLNKYWDSDLCLSKIKVNEKFKSVGFDVKNDRLAIITNERTMYFIDLPKEQQRYVEEAECRFY
Ga0314682_1062152623300032540SeawaterMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRTIYFVDLPKE
Ga0314699_1040133013300032730SeawaterMKVLNKYWDSDLCLSKIKVNEKFKSIGFDVKNNRLAIVTNDRTIY
Ga0314712_1052114513300032747SeawaterMKVLNKYWDSDLCLSKIKVNEKFKSVGFDVKNDRLAIITNERTMYFIDLPKEQQ
Ga0314713_1032727613300032748SeawaterMKVLNKYWESDLCLSKIKVNEDKKTIGFDIKNDRLAIVTHDRAIY
Ga0335005_0177777_255_4133300034022FreshwaterMKLLNKYWDGDLCLSKIKVNEKLKTIGFDAKNDKLAVVTHDRTLYYIDIPKE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.