


| Basic Information | |
|---|---|
| Family ID | F075293 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHVH |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.96 % |
| % of genes near scaffold ends (potentially truncated) | 9.24 % |
| % of genes from short scaffolds (< 2000 bps) | 77.31 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.420 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (15.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.975 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00795 | CN_hydrolase | 9.32 |
| PF02384 | N6_Mtase | 5.08 |
| PF04335 | VirB8 | 2.54 |
| PF01436 | NHL | 1.69 |
| PF04851 | ResIII | 1.69 |
| PF10502 | Peptidase_S26 | 1.69 |
| PF02534 | T4SS-DNA_transf | 1.69 |
| PF00436 | SSB | 0.85 |
| PF12543 | DUF3738 | 0.85 |
| PF05239 | PRC | 0.85 |
| PF07494 | Reg_prop | 0.85 |
| PF04610 | TrbL | 0.85 |
| PF00176 | SNF2-rel_dom | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF13328 | HD_4 | 0.85 |
| PF01850 | PIN | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3736 | Type IV secretory pathway, component VirB8 | Intracellular trafficking, secretion, and vesicular transport [U] | 2.54 |
| COG3505 | Type IV secretory pathway, VirD4 component, TraG/TraD family ATPase | Intracellular trafficking, secretion, and vesicular transport [U] | 1.69 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.85 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.85 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.85 |
| COG3704 | Type IV secretory pathway, VirB6 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| COG3846 | Type IV secretory pathway, TrbL components | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.42 % |
| Unclassified | root | N/A | 49.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005542|Ga0070732_10371678 | Not Available | 861 | Open in IMG/M |
| 3300005591|Ga0070761_10129044 | Not Available | 1472 | Open in IMG/M |
| 3300005591|Ga0070761_11027198 | Not Available | 524 | Open in IMG/M |
| 3300005602|Ga0070762_10248700 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005712|Ga0070764_10619373 | Not Available | 661 | Open in IMG/M |
| 3300006052|Ga0075029_100002227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 11029 | Open in IMG/M |
| 3300006162|Ga0075030_100021141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Thermogemmatisporales → Thermogemmatisporaceae → Thermogemmatispora → unclassified Thermogemmatispora → Thermogemmatispora sp. | 5595 | Open in IMG/M |
| 3300006172|Ga0075018_10169225 | Not Available | 1019 | Open in IMG/M |
| 3300006893|Ga0073928_10163073 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300009522|Ga0116218_1153495 | Not Available | 1045 | Open in IMG/M |
| 3300009552|Ga0116138_1033672 | Not Available | 1521 | Open in IMG/M |
| 3300009628|Ga0116125_1032429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300009633|Ga0116129_1059771 | Not Available | 1157 | Open in IMG/M |
| 3300009665|Ga0116135_1414086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae | 548 | Open in IMG/M |
| 3300009683|Ga0116224_10138405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1174 | Open in IMG/M |
| 3300009683|Ga0116224_10385720 | Not Available | 666 | Open in IMG/M |
| 3300009698|Ga0116216_10086161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium | 1933 | Open in IMG/M |
| 3300009698|Ga0116216_10167623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300009700|Ga0116217_10194818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300010379|Ga0136449_100093488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 6231 | Open in IMG/M |
| 3300010379|Ga0136449_100203939 | Not Available | 3755 | Open in IMG/M |
| 3300010379|Ga0136449_102588053 | Not Available | 724 | Open in IMG/M |
| 3300014156|Ga0181518_10196988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300014158|Ga0181521_10566222 | Not Available | 536 | Open in IMG/M |
| 3300014160|Ga0181517_10303104 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300014161|Ga0181529_10518910 | Not Available | 629 | Open in IMG/M |
| 3300014162|Ga0181538_10038454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 3084 | Open in IMG/M |
| 3300014162|Ga0181538_10233719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300014162|Ga0181538_10400174 | Not Available | 732 | Open in IMG/M |
| 3300014164|Ga0181532_10035811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 3392 | Open in IMG/M |
| 3300014164|Ga0181532_10343099 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300014165|Ga0181523_10035096 | Not Available | 3201 | Open in IMG/M |
| 3300014169|Ga0181531_10151533 | Not Available | 1402 | Open in IMG/M |
| 3300014169|Ga0181531_10486855 | Not Available | 761 | Open in IMG/M |
| 3300014200|Ga0181526_10439760 | Not Available | 827 | Open in IMG/M |
| 3300014201|Ga0181537_10957073 | Not Available | 580 | Open in IMG/M |
| 3300014489|Ga0182018_10166579 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300014491|Ga0182014_10000177 | All Organisms → cellular organisms → Bacteria | 77828 | Open in IMG/M |
| 3300014492|Ga0182013_10123968 | Not Available | 1685 | Open in IMG/M |
| 3300014492|Ga0182013_10244275 | Not Available | 1043 | Open in IMG/M |
| 3300014492|Ga0182013_10537661 | Not Available | 603 | Open in IMG/M |
| 3300014493|Ga0182016_10024638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 5236 | Open in IMG/M |
| 3300014495|Ga0182015_10064335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2626 | Open in IMG/M |
| 3300014658|Ga0181519_10672269 | Not Available | 639 | Open in IMG/M |
| 3300014838|Ga0182030_10428395 | Not Available | 1361 | Open in IMG/M |
| 3300016422|Ga0182039_10518691 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300016750|Ga0181505_10137272 | Not Available | 721 | Open in IMG/M |
| 3300016750|Ga0181505_10794310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300016750|Ga0181505_10980942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300017934|Ga0187803_10267068 | Not Available | 679 | Open in IMG/M |
| 3300017948|Ga0187847_10425525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 731 | Open in IMG/M |
| 3300017948|Ga0187847_10829284 | Not Available | 524 | Open in IMG/M |
| 3300018013|Ga0187873_1132935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300018022|Ga0187864_10219006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 890 | Open in IMG/M |
| 3300018033|Ga0187867_10131400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1446 | Open in IMG/M |
| 3300018033|Ga0187867_10295718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300018033|Ga0187867_10767538 | Not Available | 524 | Open in IMG/M |
| 3300018034|Ga0187863_10680774 | Not Available | 580 | Open in IMG/M |
| 3300018035|Ga0187875_10199162 | Not Available | 1106 | Open in IMG/M |
| 3300018037|Ga0187883_10679058 | Not Available | 537 | Open in IMG/M |
| 3300018038|Ga0187855_10893330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 519 | Open in IMG/M |
| 3300018040|Ga0187862_10150627 | Not Available | 1567 | Open in IMG/M |
| 3300018042|Ga0187871_10586513 | Not Available | 618 | Open in IMG/M |
| 3300018043|Ga0187887_10534062 | Not Available | 692 | Open in IMG/M |
| 3300018047|Ga0187859_10246184 | Not Available | 959 | Open in IMG/M |
| 3300018047|Ga0187859_10620726 | Not Available | 610 | Open in IMG/M |
| 3300018062|Ga0187784_11046251 | Not Available | 648 | Open in IMG/M |
| 3300021181|Ga0210388_10300945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1409 | Open in IMG/M |
| 3300021476|Ga0187846_10017627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3343 | Open in IMG/M |
| 3300021477|Ga0210398_10243001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1467 | Open in IMG/M |
| 3300023088|Ga0224555_1011560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5320 | Open in IMG/M |
| 3300025463|Ga0208193_1101206 | Not Available | 552 | Open in IMG/M |
| 3300027842|Ga0209580_10581389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 556 | Open in IMG/M |
| 3300027853|Ga0209274_10113129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300027879|Ga0209169_10703181 | Not Available | 524 | Open in IMG/M |
| 3300027895|Ga0209624_10399498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300027905|Ga0209415_10636870 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300027908|Ga0209006_11089031 | Not Available | 631 | Open in IMG/M |
| 3300027911|Ga0209698_10017524 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| 3300028780|Ga0302225_10144851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1152 | Open in IMG/M |
| 3300028806|Ga0302221_10352824 | Not Available | 641 | Open in IMG/M |
| 3300029999|Ga0311339_10037664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 6745 | Open in IMG/M |
| 3300029999|Ga0311339_10934469 | Not Available | 820 | Open in IMG/M |
| 3300029999|Ga0311339_11204592 | Not Available | 693 | Open in IMG/M |
| 3300029999|Ga0311339_11714347 | Not Available | 550 | Open in IMG/M |
| 3300030399|Ga0311353_10878993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae | 759 | Open in IMG/M |
| 3300030494|Ga0310037_10147613 | Not Available | 1068 | Open in IMG/M |
| 3300030494|Ga0310037_10182621 | Not Available | 938 | Open in IMG/M |
| 3300030618|Ga0311354_11229642 | Not Available | 676 | Open in IMG/M |
| 3300031234|Ga0302325_10121739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 4791 | Open in IMG/M |
| 3300031234|Ga0302325_10364749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2282 | Open in IMG/M |
| 3300031234|Ga0302325_11008504 | Not Available | 1136 | Open in IMG/M |
| 3300031236|Ga0302324_100065273 | All Organisms → cellular organisms → Bacteria | 6410 | Open in IMG/M |
| 3300031236|Ga0302324_100506677 | Not Available | 1761 | Open in IMG/M |
| 3300031236|Ga0302324_100814475 | Not Available | 1298 | Open in IMG/M |
| 3300031236|Ga0302324_102020493 | Not Available | 723 | Open in IMG/M |
| 3300031525|Ga0302326_10028055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 11339 | Open in IMG/M |
| 3300031708|Ga0310686_100069704 | Not Available | 523 | Open in IMG/M |
| 3300031753|Ga0307477_10678790 | Not Available | 690 | Open in IMG/M |
| 3300031788|Ga0302319_11518719 | Not Available | 595 | Open in IMG/M |
| 3300032160|Ga0311301_10041212 | All Organisms → cellular organisms → Bacteria | 11123 | Open in IMG/M |
| 3300032160|Ga0311301_10102681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5573 | Open in IMG/M |
| 3300032160|Ga0311301_11800831 | Not Available | 729 | Open in IMG/M |
| 3300032261|Ga0306920_101778147 | Not Available | 871 | Open in IMG/M |
| 3300032770|Ga0335085_10000026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 564256 | Open in IMG/M |
| 3300032770|Ga0335085_10000026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 564256 | Open in IMG/M |
| 3300032783|Ga0335079_10419839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
| 3300032805|Ga0335078_10056720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5769 | Open in IMG/M |
| 3300032805|Ga0335078_10177437 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
| 3300032805|Ga0335078_10559911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
| 3300032805|Ga0335078_10751804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300032805|Ga0335078_11396953 | Not Available | 791 | Open in IMG/M |
| 3300032805|Ga0335078_11648735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae | 707 | Open in IMG/M |
| 3300032828|Ga0335080_12333579 | Not Available | 511 | Open in IMG/M |
| 3300032898|Ga0335072_10002144 | All Organisms → cellular organisms → Bacteria | 31076 | Open in IMG/M |
| 3300033134|Ga0335073_10203158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2457 | Open in IMG/M |
| 3300033134|Ga0335073_11134634 | Not Available | 792 | Open in IMG/M |
| 3300033402|Ga0326728_10010424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 21764 | Open in IMG/M |
| 3300033513|Ga0316628_101401503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 15.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 12.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 11.76% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.84% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.84% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070732_103716781 | 3300005542 | Surface Soil | MWHFLFLAFQWHRGKWGFVILSLAFLAFLLCAVAHVH* |
| Ga0070761_101290442 | 3300005591 | Soil | MWNFLFLAFQWHGGKRGFVILSVAFLAFLLYAVAHVH* |
| Ga0070761_110271981 | 3300005591 | Soil | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHVH* |
| Ga0070762_102487002 | 3300005602 | Soil | MWNFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANAH* |
| Ga0070764_106193732 | 3300005712 | Soil | MWHFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH* |
| Ga0075029_10000222711 | 3300006052 | Watersheds | MMWHFLFLAFQWHRGNRGFVILSLLGLAFLLYAVIHVH* |
| Ga0075030_1000211413 | 3300006162 | Watersheds | IMMWHFLFLAFQWHRGNRGFVILSLLGLAFLLYAVIHVH* |
| Ga0075018_101692252 | 3300006172 | Watersheds | MWHFLFLAFQWQRGKRGFVILSLAFLAFLLYAVAHVR* |
| Ga0073928_101630733 | 3300006893 | Iron-Sulfur Acid Spring | MWHFLFLAFQWHRGNRGFVILSLAFLAFLLYAVIHAR* |
| Ga0116218_11534951 | 3300009522 | Peatlands Soil | MWNFLFLAFQWHRGKRSFVILSLAFLAFLLYAVAHVH* |
| Ga0116138_10336723 | 3300009552 | Peatland | MMWHFLFLAFHWHRGKRGFVILSLAFLAFLLKAVAHVR* |
| Ga0116125_10324292 | 3300009628 | Peatland | MWNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH* |
| Ga0116129_10597712 | 3300009633 | Peatland | MWNFLFLAFQWHRGKRVSVVLSLAFLAFLLYAVAHVH* |
| Ga0116135_14140861 | 3300009665 | Peatland | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVVNVH* |
| Ga0116224_101384052 | 3300009683 | Peatlands Soil | MWHFLFLAFQWHRVKRAFVILSLAFLAFLLYAVAHVH* |
| Ga0116224_103857201 | 3300009683 | Peatlands Soil | MWHFLFLAFQWHRGKRGFVIMSLAFLAFLLYAVANAH* |
| Ga0116216_100861613 | 3300009698 | Peatlands Soil | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVASIH* |
| Ga0116216_101676232 | 3300009698 | Peatlands Soil | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH* |
| Ga0116217_101948181 | 3300009700 | Peatlands Soil | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANVH* |
| Ga0136449_1000934887 | 3300010379 | Peatlands Soil | MWHFLFLAIQWHRGKRVFVIVSLAFLAFLLYAVIHVH* |
| Ga0136449_1002039393 | 3300010379 | Peatlands Soil | MLHFLFLAFQSHRGKRGFVMLSLAFLAFLLYAVAHVH* |
| Ga0136449_1025880531 | 3300010379 | Peatlands Soil | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHVH* |
| Ga0181518_101969882 | 3300014156 | Bog | MWSFLFLAFQWHRGKRGFVIVSLAFLAFLLYAVARVH* |
| Ga0181521_105662222 | 3300014158 | Bog | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVANVH* |
| Ga0181517_103031041 | 3300014160 | Bog | MWHFLFLAFQWHRGKRVFVILSLAFLAFLLYAIAHVR* |
| Ga0181529_105189101 | 3300014161 | Bog | MWHFLFLAFQWHRGKRAFVILSLAFVAFLLYAVAHIH* |
| Ga0181538_100384544 | 3300014162 | Bog | MWHFLFLAFHWHRSKRGFVILSLAFLAFLLYAVAHAH* |
| Ga0181538_102337192 | 3300014162 | Bog | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANIH* |
| Ga0181538_104001742 | 3300014162 | Bog | MWHFLFLAFQWHRGKRGFVILSLVFLAFLLYAVAHVH* |
| Ga0181532_100358114 | 3300014164 | Bog | MWHFLFLAFQWHRGKRVFVILSLAFLAFLLYATAHVR* |
| Ga0181532_103430991 | 3300014164 | Bog | MWNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHAH* |
| Ga0181523_100350963 | 3300014165 | Bog | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANVH* |
| Ga0181531_101515332 | 3300014169 | Bog | WHFLFVAFQWHRGKRAFVILSLAFLAFLLYAIAHVR* |
| Ga0181531_104868552 | 3300014169 | Bog | MWHYLFLAFQWHRGKRAFVILSLAFPAFLLYAVAHVR* |
| Ga0181526_104397601 | 3300014200 | Bog | MWHFLFLAFQWHRGKRAFVILSLAFVAFLLYAVAHIH |
| Ga0181537_109570731 | 3300014201 | Bog | MWNFLFLAFQWHRGRRAFVILSLAFLAFLLYAVANVH* |
| Ga0182018_101665792 | 3300014489 | Palsa | MWHFLFLAIQWHRGKRVFVIVSLTFLAVLLYAIIHVH* |
| Ga0182014_1000017721 | 3300014491 | Bog | MWNFLFLAFQWHRGKRGFVILSLTFLAFLLYAVANVH* |
| Ga0182013_101239682 | 3300014492 | Bog | MWHFLFLVFQWQSGKRSFVILSLAFLAFLLYAIAHIH* |
| Ga0182013_102442752 | 3300014492 | Bog | MSHFLFLAFQWHRGKRGFVILSLAFLAFLLYSVAHVH* |
| Ga0182013_105376612 | 3300014492 | Bog | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVR* |
| Ga0182016_100246384 | 3300014493 | Bog | MWHFLFLAFQWQSGKRSFAILSLAFLAFLLYAIAHIH* |
| Ga0182015_100643352 | 3300014495 | Palsa | MWKFLFLAFQWHRGKRAFVILSLAFLAFLLYAVANVH* |
| Ga0181519_106722691 | 3300014658 | Bog | MMWHFLFLAFHWHRGKRGFVILSLAFLAFLLYAVAHAH* |
| Ga0182030_104283952 | 3300014838 | Bog | MWHFLFLAFQWQSGKRSFVILSLAFLAFLPYAIAHIH* |
| Ga0182039_105186912 | 3300016422 | Soil | MKWHLLFLAFQWHRGNRAFVLLCLLGLAFLLYTVAQLR |
| Ga0181505_101372723 | 3300016750 | Peatland | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAIAHVR |
| Ga0181505_107943101 | 3300016750 | Peatland | MWNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH |
| Ga0181505_109809421 | 3300016750 | Peatland | MWSFLFLAFQWHRGKRGFVIVSLAFLAFLLYAVARVH |
| Ga0187803_102670682 | 3300017934 | Freshwater Sediment | MWNLLFLAFQWHRGKRWFVILSLAFLAFLLYAVAHIH |
| Ga0187847_104255252 | 3300017948 | Peatland | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHAH |
| Ga0187847_108292842 | 3300017948 | Peatland | MWHFLFLAFQWHRGKRGFVIASLVFLAFLLYAVENVH |
| Ga0187873_11329351 | 3300018013 | Peatland | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0187864_102190061 | 3300018022 | Peatland | MWNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAKVH |
| Ga0187867_101314003 | 3300018033 | Peatland | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVANIH |
| Ga0187867_102957181 | 3300018033 | Peatland | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHVH |
| Ga0187867_107675381 | 3300018033 | Peatland | KDVRTTWHYLFLAVQWHRGKRAFATLSLALLALLLYAVAHAH |
| Ga0187863_106807741 | 3300018034 | Peatland | MWHFLFLAFHWHRSKRGFVILSLAFLAFLLYAVAHAH |
| Ga0187875_101991622 | 3300018035 | Peatland | MWSFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH |
| Ga0187883_106790581 | 3300018037 | Peatland | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHAR |
| Ga0187855_108933301 | 3300018038 | Peatland | MWNFLFLAFQWHRGKRGFVILSLSFLAFLLYAVAHVH |
| Ga0187862_101506272 | 3300018040 | Peatland | MWHFLFLAFQWHRGKRGFAILFLAFLAFLLHAVAHVH |
| Ga0187871_105865132 | 3300018042 | Peatland | MWHFLFLAFQWHRGKRGFAILSLAFLALLLYVVAHAH |
| Ga0187887_105340622 | 3300018043 | Peatland | MWHFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANVR |
| Ga0187859_102461842 | 3300018047 | Peatland | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0187859_106207262 | 3300018047 | Peatland | WNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH |
| Ga0187784_110462511 | 3300018062 | Tropical Peatland | MRWHLLFLAYQWYRGNHAFVILCLLGIAFLLYCVAQLR |
| Ga0210388_103009452 | 3300021181 | Soil | MWHVLFLAIRWHRGKRVFVMVSLVFLTFLLYAATHVH |
| Ga0187846_100176276 | 3300021476 | Biofilm | MWNFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHAH |
| Ga0210398_102430013 | 3300021477 | Soil | MWHLLFLAFQWHRGNRAFVLLSLVFLCLLLYCLVHVR |
| Ga0224555_10115603 | 3300023088 | Soil | MWNFLFLAFQWHRGKRGFVILSLTFLAFLLYAVANVH |
| Ga0208193_11012061 | 3300025463 | Peatland | MWNFLFLAFQWHRGKRVSVVLSLAFLAFLLYAVAHVH |
| Ga0209580_105813891 | 3300027842 | Surface Soil | MWHFLFLAFQWHRGKWGFVILSLAFLAFLLCAVAHVH |
| Ga0209274_101131291 | 3300027853 | Soil | MWNFLFLAFQWHGGKRGFVILSVAFLAFLLYAVAHVH |
| Ga0209169_107031811 | 3300027879 | Soil | MWHFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0209624_103994982 | 3300027895 | Forest Soil | MWHLLFLALQWHRGNRAFVLLSLVFLCLLLYCLVHVR |
| Ga0209415_106368702 | 3300027905 | Peatlands Soil | MLHFLFLAFQWHRGKRGFVMLSLAFLAFLLYAVAHVH |
| Ga0209006_110890312 | 3300027908 | Forest Soil | MWNFLFLAFQWHHGKRGFVILSLAFLAFLLYAVAHVH |
| Ga0209698_100175242 | 3300027911 | Watersheds | MMWHFLFLAFQWHRGNRGFVILSLLGLAFLLYAVIHVH |
| Ga0302225_101448513 | 3300028780 | Palsa | MWHFLFLAFQWHRGKRGFVMLSLAFLAFLLYAVANV |
| Ga0302221_103528241 | 3300028806 | Palsa | MWHFLFLAFQWHRGKRGFVMLSLAFLAFLLYAVANVR |
| Ga0311339_100376643 | 3300029999 | Palsa | MWNLLFLAFEWQRGNRSFVLLSLAFLCFLLYCVAQLR |
| Ga0311339_109344691 | 3300029999 | Palsa | MWHFLFLGFRWHRGKRGFVMLSLPFLAFLLYAAAHVH |
| Ga0311339_112045921 | 3300029999 | Palsa | MWNFLFLAFQWHRGKRGFVILSLVFLAFLLYAVGHGR |
| Ga0311339_117143472 | 3300029999 | Palsa | MWHFLFLAFQRHSGKRGLVILSPALLAFLLYGVAHSH |
| Ga0311353_108789932 | 3300030399 | Palsa | MWNLLFLAFQWHRGNRSFVLLSLAFLCFLLYCVAQLR |
| Ga0310037_101476132 | 3300030494 | Peatlands Soil | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVAHVH |
| Ga0310037_101826211 | 3300030494 | Peatlands Soil | MWHFLFLAFQWHRGKRGFVIMSLAFLAFLLYAVANAH |
| Ga0311354_112296422 | 3300030618 | Palsa | MWHLLFLAFQWHRGKRSFVILSLAFLAFLLYAVAHVH |
| Ga0302325_101217393 | 3300031234 | Palsa | MWHLLFLAFQWHRGNRAFVLLSLAFLCFLLYCLVHVR |
| Ga0302325_103647492 | 3300031234 | Palsa | MWNFLFLAFQWQRGKRGFVILSLAFLAFLLYAVVHVH |
| Ga0302325_110085042 | 3300031234 | Palsa | MWDFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0302324_1000652732 | 3300031236 | Palsa | MWNLLFLAFQWHRGKRSFVLLSLAFLCFLLYCVAQLR |
| Ga0302324_1005066772 | 3300031236 | Palsa | MWKFLFLAFQWHRGKRAFVILSLAFLAFLLYAVANVH |
| Ga0302324_1008144751 | 3300031236 | Palsa | SEHLKEIRAMWDFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0302324_1020204932 | 3300031236 | Palsa | MWNFLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0302326_100280553 | 3300031525 | Palsa | MWNLLFLAFQWQRGNRSFVLLSLAFLCFLLYCVAQLR |
| Ga0310686_1000697042 | 3300031708 | Soil | MWNVLFLAFQWQRGKRGFVILSLAFLAFLLYAVANVH |
| Ga0307477_106787902 | 3300031753 | Hardwood Forest Soil | MWHFLFLAFQWHRGKRGFVILSLASLAFVLYAVAHVH |
| Ga0302319_115187192 | 3300031788 | Bog | MWHFLFLAFQWHRGKRSFVILSLAFLAFLLYAITHLH |
| Ga0311301_100412126 | 3300032160 | Peatlands Soil | MWHFLFLAFQWHRGKRAFVILSLAFLAFLLYAVASIH |
| Ga0311301_101026812 | 3300032160 | Peatlands Soil | MWHFLFLAIQWHRGKRVFVIVSLAFLAFLLYAVIHVH |
| Ga0311301_118008311 | 3300032160 | Peatlands Soil | MLHFLFLAFQSHRGKRGFVMLSLAFLAFLLYAVAH |
| Ga0306920_1017781472 | 3300032261 | Soil | MKWHLLFLAFQWHRGNRAFVILCLLGLAFLLYTVAQL |
| Ga0335085_10000026119 | 3300032770 | Soil | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLHAVAHAH |
| Ga0335085_1000002697 | 3300032770 | Soil | MWHFLFLAFQWHRGKRGFVILSLVFLAFLLYAVAHVH |
| Ga0335079_104198392 | 3300032783 | Soil | MKWHLLFLAFQWHRGNRAFVILCLLGLAFLIYTVAQLR |
| Ga0335078_100567205 | 3300032805 | Soil | LKGDIRVKWQLLFLAYQWRRGNRAVVILCLLGAAFLLYTVAQLR |
| Ga0335078_101774372 | 3300032805 | Soil | MWHFLFLAFQWNRGKRVIVIVSLALLAYFLYAIAHVR |
| Ga0335078_105599112 | 3300032805 | Soil | MRWHLLFLAFQWHRGNRAFVILCLLGLAFLLYTVAQL |
| Ga0335078_107518042 | 3300032805 | Soil | MWNLLFLAFMWHRGNKGVVILSLLGIAFLLYCVAQIR |
| Ga0335078_113969531 | 3300032805 | Soil | MWNFLFLAFQWHRGKRGFVILSLAFLAFLLYAVAHVR |
| Ga0335078_116487352 | 3300032805 | Soil | MWNFLLLAFQWHRGKRAFVILSLAFLAFLLYAVAHAH |
| Ga0335080_123335791 | 3300032828 | Soil | MWNFLFLAFQWHRGKRAFVVLSLAFLAFLLYTVAHAH |
| Ga0335072_100021448 | 3300032898 | Soil | MWHFLFLAFQWNRGKRVFVIVSLALLAYFLYAIAHVR |
| Ga0335073_102031582 | 3300033134 | Soil | MRWHLLFLAFQWHRGNRAFVILCLLGLAFLLYTVAQLR |
| Ga0335073_111346342 | 3300033134 | Soil | MWHFLFLAFQWHRGKRGFVILSLALLAFLLYAIEHVR |
| Ga0326728_100104245 | 3300033402 | Peat Soil | MWHFLFLAFQWHRGKRVFVILSLAFLAFLLYATAHVR |
| Ga0316628_1014015032 | 3300033513 | Soil | MWNLLFLAFQWHRGKHGFVIASLIILAFLLYTVAH |
| ⦗Top⦘ |