NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F075277

Metagenome Family F075277

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075277
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 42 residues
Representative Sequence ALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG
Number of Associated Samples 93
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.48 %
% of genes from short scaffolds (< 2000 bps) 89.08 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.311 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(55.462 % of family members)
Environment Ontology (ENVO) Unclassified
(68.908 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(56.303 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.29%    β-sheet: 0.00%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF02321OEP 52.10
PF03976PPK2 10.08
PF13533Biotin_lipoyl_2 1.68
PF13847Methyltransf_31 0.84
PF13637Ank_4 0.84
PF00365PFK 0.84
PF00924MS_channel 0.84
PF00892EamA 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 104.20
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 10.08
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.84
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.84
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.31 %
UnclassifiedrootN/A22.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_11189370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae521Open in IMG/M
3300005764|Ga0066903_108963646All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300005843|Ga0068860_101519956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300006172|Ga0075018_10529834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae618Open in IMG/M
3300006175|Ga0070712_100842225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300006176|Ga0070765_100256042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1606Open in IMG/M
3300006176|Ga0070765_101277682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300006176|Ga0070765_101690702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300006954|Ga0079219_11521259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300007258|Ga0099793_10252716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium851Open in IMG/M
3300009792|Ga0126374_11722105Not Available522Open in IMG/M
3300010358|Ga0126370_11571801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300010361|Ga0126378_12876742Not Available549Open in IMG/M
3300010362|Ga0126377_11112035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium859Open in IMG/M
3300010362|Ga0126377_13002815All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales544Open in IMG/M
3300010366|Ga0126379_11229036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300010376|Ga0126381_100112169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3509Open in IMG/M
3300012363|Ga0137390_10789728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium908Open in IMG/M
3300016341|Ga0182035_11594159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300016357|Ga0182032_11471610Not Available591Open in IMG/M
3300016357|Ga0182032_12060979Not Available501Open in IMG/M
3300016371|Ga0182034_10181665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1611Open in IMG/M
3300016371|Ga0182034_10742476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300016371|Ga0182034_11734830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae550Open in IMG/M
3300016387|Ga0182040_10575334Not Available909Open in IMG/M
3300016404|Ga0182037_10038664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae3100Open in IMG/M
3300016404|Ga0182037_10458687Not Available1061Open in IMG/M
3300016422|Ga0182039_10290650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1350Open in IMG/M
3300016445|Ga0182038_10414724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1132Open in IMG/M
3300018060|Ga0187765_10237647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1068Open in IMG/M
3300018062|Ga0187784_10715780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium801Open in IMG/M
3300019789|Ga0137408_1250979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300020199|Ga0179592_10073495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1566Open in IMG/M
3300020580|Ga0210403_10204778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1619Open in IMG/M
3300021181|Ga0210388_10825890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300021433|Ga0210391_11002885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300021439|Ga0213879_10121812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300021560|Ga0126371_12229547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300021560|Ga0126371_13860436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae505Open in IMG/M
3300025916|Ga0207663_10313585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1176Open in IMG/M
3300026557|Ga0179587_10391995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300027605|Ga0209329_1001470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3460Open in IMG/M
3300028906|Ga0308309_10582768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300031231|Ga0170824_118575101Not Available512Open in IMG/M
3300031543|Ga0318516_10767663All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales545Open in IMG/M
3300031544|Ga0318534_10112144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1565Open in IMG/M
3300031545|Ga0318541_10598310Not Available617Open in IMG/M
3300031546|Ga0318538_10823592Not Available504Open in IMG/M
3300031549|Ga0318571_10019743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1748Open in IMG/M
3300031561|Ga0318528_10474024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300031572|Ga0318515_10131463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1327Open in IMG/M
3300031572|Ga0318515_10767150Not Available509Open in IMG/M
3300031713|Ga0318496_10615961All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300031736|Ga0318501_10208063Not Available1026Open in IMG/M
3300031747|Ga0318502_10429750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300031748|Ga0318492_10626755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae574Open in IMG/M
3300031753|Ga0307477_10224245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1304Open in IMG/M
3300031754|Ga0307475_11554708All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales506Open in IMG/M
3300031764|Ga0318535_10342418Not Available668Open in IMG/M
3300031765|Ga0318554_10267221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium974Open in IMG/M
3300031768|Ga0318509_10597923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031770|Ga0318521_10839909All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031771|Ga0318546_10053731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2518Open in IMG/M
3300031779|Ga0318566_10193570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1009Open in IMG/M
3300031781|Ga0318547_10078932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1839Open in IMG/M
3300031781|Ga0318547_11037924All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300031792|Ga0318529_10457682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae594Open in IMG/M
3300031798|Ga0318523_10074498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1636Open in IMG/M
3300031805|Ga0318497_10035543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2509Open in IMG/M
3300031821|Ga0318567_10232496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1033Open in IMG/M
3300031821|Ga0318567_10423966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300031831|Ga0318564_10182084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium936Open in IMG/M
3300031835|Ga0318517_10507398All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300031846|Ga0318512_10048271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1892Open in IMG/M
3300031846|Ga0318512_10710729Not Available515Open in IMG/M
3300031859|Ga0318527_10183120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium884Open in IMG/M
3300031860|Ga0318495_10203612Not Available891Open in IMG/M
3300031860|Ga0318495_10245407Not Available802Open in IMG/M
3300031879|Ga0306919_10076431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2296Open in IMG/M
3300031879|Ga0306919_10248317Not Available1338Open in IMG/M
3300031880|Ga0318544_10139136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium927Open in IMG/M
3300031893|Ga0318536_10573036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae565Open in IMG/M
3300031896|Ga0318551_10062473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1908Open in IMG/M
3300031897|Ga0318520_10243581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1071Open in IMG/M
3300031897|Ga0318520_10670832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae647Open in IMG/M
3300031910|Ga0306923_11525354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031912|Ga0306921_10104945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3278Open in IMG/M
3300031941|Ga0310912_10275469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1299Open in IMG/M
3300031941|Ga0310912_10291942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1261Open in IMG/M
3300031942|Ga0310916_10184347Not Available1740Open in IMG/M
3300031945|Ga0310913_10442442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium923Open in IMG/M
3300031947|Ga0310909_10869415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium742Open in IMG/M
3300031947|Ga0310909_11294928All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031947|Ga0310909_11604658All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031954|Ga0306926_10242347All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300031959|Ga0318530_10497002All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031959|Ga0318530_10509811Not Available500Open in IMG/M
3300031981|Ga0318531_10165659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium992Open in IMG/M
3300031981|Ga0318531_10389028Not Available631Open in IMG/M
3300031981|Ga0318531_10532887All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300032001|Ga0306922_10548814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1229Open in IMG/M
3300032001|Ga0306922_10976126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300032010|Ga0318569_10243565Not Available835Open in IMG/M
3300032043|Ga0318556_10073353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1697Open in IMG/M
3300032052|Ga0318506_10001506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5993Open in IMG/M
3300032055|Ga0318575_10217799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium960Open in IMG/M
3300032059|Ga0318533_10373137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1040Open in IMG/M
3300032059|Ga0318533_11077699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae589Open in IMG/M
3300032059|Ga0318533_11343094Not Available522Open in IMG/M
3300032064|Ga0318510_10385301Not Available595Open in IMG/M
3300032066|Ga0318514_10258366Not Available918Open in IMG/M
3300032066|Ga0318514_10656230Not Available558Open in IMG/M
3300032068|Ga0318553_10228889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300032090|Ga0318518_10224656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium963Open in IMG/M
3300032205|Ga0307472_100098830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2001Open in IMG/M
3300033290|Ga0318519_10208386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1117Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil55.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.20%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.36%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1118937013300004080Bog Forest SoilLATWYRLLHEDIRKILDEVGPEPLLRVAPSVGDPLHAAG*
Ga0066903_10896364623300005764Tropical Forest SoilSGRCEHLTALATWYRLLHQDIREILDQVGPQPQPAIAPPVGDVLHAAG*
Ga0068860_10151995623300005843Switchgrass RhizosphereATWYGVLHQGIRKILDEVAPQPQSVIEPSGGDPLHATG*
Ga0075018_1052983423300006172WatershedsTWYGVLHQDIRKILDEIGPQPQSVIEPSVGDALHATG*
Ga0070712_10084222513300006175Corn, Switchgrass And Miscanthus RhizosphereYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG*
Ga0070765_10025604213300006176SoilDHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG*
Ga0070765_10127768223300006176SoilATWYRLLHEDIRKILDEVGPQPQLPIMPSFGDALHATG*
Ga0070765_10169070223300006176SoilDHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDAFHATG*
Ga0079219_1152125923300006954Agricultural SoilHLTALATWYGVLHHDIRKILDEVGPQPRPVTAPSVGDAFHATG*
Ga0099793_1025271613300007258Vadose Zone SoilAAWYGVLHQDIRKILDEVGPQPRPVIAPSVEDALHASG*
Ga0126374_1172210513300009792Tropical Forest SoilNRRPYDQLTALATWYGVLHHDIRKILDEVGPQLHPMTSPSVEDALHATG*
Ga0126380_1020256423300010043Tropical Forest SoilWYGLLHQDIRNILDEAGPQPQRPIPSPAGEALHAVR*
Ga0126370_1157180123300010358Tropical Forest SoilQLTALATWYGVLHQDSRKILDEVGPQLHPMTSPSVEDALHATG*
Ga0126378_1287674223300010361Tropical Forest SoilLATWYRLLHEDIRKILDEVGPQPQPLIAPPVGDALHAAG*
Ga0126377_1111203513300010362Tropical Forest SoilLTALATWYGVLHEDIRNILDEVGPQPGPVMAPSVGDALHATG*
Ga0126377_1300281523300010362Tropical Forest SoilDHLAALATWYGVLHQDIRKILDEVGPRRQTVIEPSVVDPLHAAG*
Ga0126379_1122903613300010366Tropical Forest SoilLSGPGDHLTALATWYGVLHQDIRKILDEVGPRRQTVIEPSVVDPLHAAG*
Ga0126381_10011216943300010376Tropical Forest SoilLATWYGVLHQDIRKILDEVGPQATPLVPQPVRDAWHAAG*
Ga0137390_1078972813300012363Vadose Zone SoilWYGVLHQDIRKILDEVGPQPRPVIAPSVGDVFHATG*
Ga0182035_1159415923300016341SoilSLAMWYGLLHQDIRKILDEVGPQATPLVPQPVRDAWHAAG
Ga0182032_1147161013300016357SoilGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0182032_1206097923300016357SoilILSGPGDQLTALATWYGLLHQDIRRILDEVGPRRDPVIAPSVGRALHAAG
Ga0182034_1018166523300016371SoilLSGPGDHLTALATWYGVLHQDIRKILDEVGPQATPLVPQPVRDVWHAAG
Ga0182034_1074247613300016371SoilTWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0182034_1173483023300016371SoilTALTTWYGVLHQDIRKILNEVGPQPQAVLTPWVEDVLHAVG
Ga0182040_1057533413300016387SoilTALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG
Ga0182037_1003866413300016404SoilTWYRVLHEDIREILDKVGPQPQPLIAPSVGDALHATG
Ga0182037_1045868713300016404SoilDHLTALATWYGLLHQDIRNVLDEVGPRRPPMIEPSVGDALHAAG
Ga0182037_1089801213300016404SoilALATWYGLLHQDIRNILDKVGPEPQPVKVPSVGDALHATG
Ga0182039_1029065013300016422SoilTWYGVLHEDIRKILDEVGPQPRPMTAPVGAALHATG
Ga0182038_1041472423300016445SoilLATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG
Ga0187765_1023764713300018060Tropical PeatlandGDRLMALATWYGVLHNDIVKILDEVGPQSKAVTAPSIGDALHAAG
Ga0187784_1071578013300018062Tropical PeatlandPDDPLTALAAWHGLLHQDIRNILDEVGPQPQPTTAPSLGEALRAAG
Ga0137408_125097923300019789Vadose Zone SoilTWYGVLHHDIRKILDEVGPQPRPVIAPSVGDAFHATG
Ga0179592_1007349523300020199Vadose Zone SoilGPGDHLTALATWYGVLHQDIRKILDEVGPQPQPVIAPPVGDAFHAAG
Ga0210403_1020477823300020580SoilDPGDHLTALATWYGVLHQDIRKILDEVGPQPQPVIAPSVGDAVHAAG
Ga0210388_1082589023300021181SoilPPLSGPGDHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG
Ga0210391_1100288523300021433SoilAFTTWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG
Ga0213879_1012181223300021439Bulk SoilATWYRLLHQDIREILGQVGPQPQPMIAPSVRDPLHADG
Ga0126371_1222954723300021560Tropical Forest SoilLATWYRLLHEDIRKILDEVGPQPQPLIAPSVGDALHAAG
Ga0126371_1386043613300021560Tropical Forest SoilTWYGLLYQDIRRILDQVGPQPQPVTATSVRDALHAAG
Ga0207663_1031358523300025916Corn, Switchgrass And Miscanthus RhizosphereAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG
Ga0179587_1039199513300026557Vadose Zone SoilRTALATWYGVLHQDIRRILDEVGPQPQPVIAPPVGDAFHAAG
Ga0209329_100147043300027605Forest SoilLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG
Ga0308309_1058276813300028906SoilHFTALARWYRLLHEDIRKILDEVGPQPQLPIMPSFGDALHATG
Ga0170824_11857510113300031231Forest SoilPGDHLTALATWYGMLHQDICKILDEVGPQPQPIAPPVGDGFRAIG
Ga0318516_1076766323300031543SoilLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0318534_1011214413300031544SoilEPPILTGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0318541_1059831013300031545SoilSDDHLIAFATWYGVLHEDIRKILDEIGPQPQPAIAQSVTDALRAAG
Ga0318538_1082359213300031546SoilTWYGLLHQDIRNVLDEVGPRRPPMIEPSVGDALHAAG
Ga0318571_1001974313300031549SoilPGDHLTALATWYGLLHQDIRKILDEVGPRRQPVIEPSVGDALHAAG
Ga0318528_1047402423300031561SoilGDHLTALATWYGVLHQDIRKILDEVGPQPRLVAAPSVGEALHAAG
Ga0318573_1049554213300031564SoilAALATWYGLLHQDIRNILDKVGPEPQPVKVPSVGDALHAAG
Ga0318515_1013146313300031572SoilLATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0318515_1076715023300031572SoilVLSGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0318496_1061596113300031713SoilTWYGVLHEDIRKILDEVGPQPRPAIARPVADALHAAG
Ga0318501_1020806313300031736SoilYGLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG
Ga0318502_1042975023300031747SoilGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0318492_1062675523300031748SoilLALATWYGVLHQDIRSILDEVGPQPQPVTAPPVRDALHAAR
Ga0307477_1022424523300031753Hardwood Forest SoilAAFATWYRLLHEDIRKILDEVGPRPQLPITPSFGDALHATG
Ga0307475_1155470813300031754Hardwood Forest SoilYRLLHEDIRKILDEVGPQPQLPITPSFGDAFHATG
Ga0318535_1034241813300031764SoilTGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG
Ga0318554_1026722123300031765SoilGPGDHLTALATWYGVLRQDIRNILDEVGPQPRPVIARSVADALHAAG
Ga0318509_1059792323300031768SoilLILTGPGDQFTALATWYGVLHRDIRKILDEVGPQATPLVPHPVGDALRAAG
Ga0318521_1083990923300031770SoilGPGDHLTALATWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG
Ga0318546_1005373113300031771SoilLATWHGVLHEDIRKILDQVGPQPQPARAPVGDALHAAG
Ga0318566_1019357023300031779SoilYRLLHEDIREILDEVGPQPQPLTAQSVGDALHAAG
Ga0318547_1007893233300031781SoilYGVLHQDIRSILDEVGPQPQPVTVPSVGDALHATG
Ga0318547_1103792413300031781SoilPTLSGRGDHLTALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG
Ga0318529_1045768223300031792SoilGDHLTALATWYGVLRQDIRNILDEVGPQPRPVIVRSVADALHAAG
Ga0318523_1007449813300031798SoilTALATWYGLLHQDIRKILDEVGPQPQPLMAQPVGDALHAAG
Ga0318497_1003554313300031805SoilYGLLHQDIHKILDEVGPEATPLIQQPVGDALHAAG
Ga0318567_1023249613300031821SoilATWYGVLHQDIRRILDEVGPQPQPGIEPSVRDALHAAG
Ga0318567_1042396623300031821SoilDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0318564_1018208423300031831SoilGDQLAALATWYRVLHQDIRKILDEVGPQPVNAPSVGDPLHAAG
Ga0318517_1050739813300031835SoilHLTALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG
Ga0318512_1004827113300031846SoilGDHLTALATWYGVLHQDVRNILDEVGPQPRPVTEPPVGDALHAAG
Ga0318512_1071072923300031846SoilTWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG
Ga0318527_1018312013300031859SoilSGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0318495_1020361223300031860SoilTTALATWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG
Ga0318495_1024540723300031860SoilAFATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG
Ga0306919_1007643133300031879SoilTALATWHGVLHEDIRKILDQVGPQPQPARAPVGDALHAGG
Ga0306919_1024831743300031879SoilSGVLHQDIRKILDEVGPQRQPVIEPSVGDALHAAG
Ga0318544_1013913613300031880SoilMLSGRGDQLTALATWYGVLHEDIRKILDEVGPQPRPMTAPVGAALHATG
Ga0318536_1057303623300031893SoilWYRVLHEDIREILDKVGPQPQPLIAPSVGDALHATG
Ga0318551_1006247343300031896SoilLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0318520_1024358123300031897SoilTWYGVLHQDIRKILNEVGPQPQAVLTPLVEDVLHAVG
Ga0318520_1067083223300031897SoilGDHQTALVTWYGLLHQDIRKILDDVGPRRQPATAPPVGDALHAAG
Ga0306923_1152535413300031910SoilWYRLLHEDIRKILDEVGPQPQSVIAPSVRDALDAAG
Ga0306921_1010494513300031912SoilILTGPGDQFTALATWYGVLHRDIRKILDEVGPQATPLVPHPVGDALRAAG
Ga0310912_1027546913300031941SoilDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG
Ga0310912_1029194213300031941SoilDQLAALATWYRVLHQDIRKILDEVGPQPVNAPSVGDPLHAAG
Ga0310916_1018434723300031942SoilEPPILSGPGDHLTALATWYGLLHQDIRKILNEVGPQSQPVTVPPVGDALHATG
Ga0310913_1044244223300031945SoilDHLTALTTWYGVLHQDIRKILNEVGPQPQAVLTPWVEDVLHAVG
Ga0310909_1086941523300031947SoilALATWYGLLHQDIRRILDEVGPRRDPVIAPSVGRALHAAG
Ga0310909_1129492813300031947SoilQGDHLTALATWYGLLHQDFRKVLDEIGPQTQPAIAQSVADALHAAG
Ga0310909_1160465813300031947SoilLTTWYRLLHEDICEILDQVGPQPQSVTAPSVGDALHAAG
Ga0306926_1024234713300031954SoilATWFDLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG
Ga0318530_1049700223300031959SoilALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG
Ga0318530_1050981123300031959SoilTWYGVLHQDIRRILDEVGPQPQPGIEPSVRDALHAAG
Ga0318531_1016565913300031981SoilHLTGLATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG
Ga0318531_1038902823300031981SoilCYGVLYQDIRNILDEVGPQPQALIASSFGNALHRTG
Ga0318531_1053288713300031981SoilLTALATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHVIS
Ga0306922_1054881423300032001SoilLAAWHGVLHQDIRNILDEVGPQPHRATAPSVEDALHAAG
Ga0306922_1097612623300032001SoilYGLLHQDIRRILDEIGPQPQPAATPSLGDAFHALG
Ga0318569_1024356513300032010SoilGDHLTALATWYGLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG
Ga0318556_1007335313300032043SoilGDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0318506_1000150613300032052SoilDHLTALATWYGVLHQDIRKILDEVGPQATPLVPQPVRDVWHAAG
Ga0318575_1021779913300032055SoilAEPPTLSGAGDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0318533_1037313713300032059SoilGDHLTGLATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG
Ga0318533_1107769923300032059SoilWYRLLHEDIRNILDEVGPQPQPAIARSVGDALHAAG
Ga0318533_1134309413300032059SoilGPGDHLAALATWYGVLHRDIRNILDEVGPQPHRATAPPVEDALHATG
Ga0318510_1038530123300032064SoilALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG
Ga0318514_1025836633300032066SoilSGVLHQDIRKILDEGGPQRQPVIEPSVGDALHAAG
Ga0318514_1065623023300032066SoilSGPGDHLTALATWYGLLHQDIRNILNEVGPQPHLVTAPSVREALHAAG
Ga0318553_1022888923300032068SoilGDHLTALATWYGVLHQDICKILEEVGPQPRPVTAPSVGDALHAAG
Ga0318518_1022465613300032090SoilGPAEPPTLSGAGDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG
Ga0307472_10009883013300032205Hardwood Forest SoilPGDYLTALATWYGLLHEDIRKIIDVVDPQSQPVTSPSVRNSLHAAG
Ga0318519_1020838623300033290SoilATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.