Basic Information | |
---|---|
Family ID | F075099 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 38 residues |
Representative Sequence | LQIMMVPADGKFFFANDVLRSMNAANHASQAEEPEDQQPK |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.84 % |
% of genes near scaffold ends (potentially truncated) | 95.80 % |
% of genes from short scaffolds (< 2000 bps) | 84.03 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.555 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.244 % of family members) |
Environment Ontology (ENVO) | Unclassified (15.966 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.782 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00496 | SBP_bac_5 | 12.61 |
PF01145 | Band_7 | 1.68 |
PF02012 | BNR | 0.84 |
PF00848 | Ring_hydroxyl_A | 0.84 |
PF02129 | Peptidase_S15 | 0.84 |
PF00440 | TetR_N | 0.84 |
PF00128 | Alpha-amylase | 0.84 |
PF02518 | HATPase_c | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.68 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.84 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.84 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.84 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.55 % |
Unclassified | root | N/A | 13.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12374013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 784 | Open in IMG/M |
3300001154|JGI12636J13339_1000360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7573 | Open in IMG/M |
3300001356|JGI12269J14319_10023300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4335 | Open in IMG/M |
3300001471|JGI12712J15308_10202188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 522 | Open in IMG/M |
3300001686|C688J18823_10011538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5806 | Open in IMG/M |
3300002562|JGI25382J37095_10016572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2825 | Open in IMG/M |
3300005166|Ga0066674_10445205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 592 | Open in IMG/M |
3300005175|Ga0066673_10415573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 787 | Open in IMG/M |
3300005330|Ga0070690_101355439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 571 | Open in IMG/M |
3300005434|Ga0070709_11652149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300005435|Ga0070714_101942715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 574 | Open in IMG/M |
3300005436|Ga0070713_100996379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 808 | Open in IMG/M |
3300005537|Ga0070730_10816536 | Not Available | 587 | Open in IMG/M |
3300005541|Ga0070733_11111310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300005542|Ga0070732_10156251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
3300005542|Ga0070732_10242978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1078 | Open in IMG/M |
3300005542|Ga0070732_10335632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 909 | Open in IMG/M |
3300005554|Ga0066661_10753340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 570 | Open in IMG/M |
3300005559|Ga0066700_11062654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 530 | Open in IMG/M |
3300005563|Ga0068855_100958315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 901 | Open in IMG/M |
3300005566|Ga0066693_10123950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 952 | Open in IMG/M |
3300005574|Ga0066694_10488690 | Not Available | 574 | Open in IMG/M |
3300005591|Ga0070761_10303872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 961 | Open in IMG/M |
3300005712|Ga0070764_10092631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1605 | Open in IMG/M |
3300005712|Ga0070764_10891028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 557 | Open in IMG/M |
3300005841|Ga0068863_100172336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2076 | Open in IMG/M |
3300005993|Ga0080027_10220575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 743 | Open in IMG/M |
3300006032|Ga0066696_10515566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300006050|Ga0075028_100628239 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300006059|Ga0075017_100108327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1942 | Open in IMG/M |
3300006102|Ga0075015_100793573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300006162|Ga0075030_101638986 | Not Available | 503 | Open in IMG/M |
3300006176|Ga0070765_101757215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300006176|Ga0070765_101928686 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009012|Ga0066710_104706551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009518|Ga0116128_1133794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300009520|Ga0116214_1439491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300009623|Ga0116133_1142140 | Not Available | 626 | Open in IMG/M |
3300009839|Ga0116223_10236184 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300010358|Ga0126370_12215688 | Not Available | 542 | Open in IMG/M |
3300010362|Ga0126377_10323700 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300010396|Ga0134126_11909843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300011271|Ga0137393_11424230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300012200|Ga0137382_11266263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300012208|Ga0137376_11571521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300012211|Ga0137377_10609927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
3300012349|Ga0137387_10575257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
3300012362|Ga0137361_10568790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1039 | Open in IMG/M |
3300012685|Ga0137397_10779728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300012925|Ga0137419_10004203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7018 | Open in IMG/M |
3300012986|Ga0164304_11462080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300012989|Ga0164305_10753003 | Not Available | 802 | Open in IMG/M |
3300013306|Ga0163162_11489274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
3300014154|Ga0134075_10331198 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300014156|Ga0181518_10538280 | Not Available | 549 | Open in IMG/M |
3300014167|Ga0181528_10650212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300015372|Ga0132256_102943052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300017933|Ga0187801_10116815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1022 | Open in IMG/M |
3300017936|Ga0187821_10127837 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300017947|Ga0187785_10018636 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
3300017973|Ga0187780_10556526 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300017975|Ga0187782_10106701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2063 | Open in IMG/M |
3300017975|Ga0187782_10618075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300017994|Ga0187822_10081560 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300018012|Ga0187810_10483255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300018013|Ga0187873_1330962 | Not Available | 557 | Open in IMG/M |
3300018038|Ga0187855_10464958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300018043|Ga0187887_10130768 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
3300018062|Ga0187784_11146632 | Not Available | 617 | Open in IMG/M |
3300018088|Ga0187771_11367874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300018482|Ga0066669_10021056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3649 | Open in IMG/M |
3300018482|Ga0066669_11332425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300020018|Ga0193721_1016363 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300020150|Ga0187768_1114766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300021171|Ga0210405_10337161 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300021181|Ga0210388_11539317 | Not Available | 554 | Open in IMG/M |
3300021406|Ga0210386_10030503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4229 | Open in IMG/M |
3300021406|Ga0210386_10672605 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300021406|Ga0210386_10846913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300021407|Ga0210383_10344976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1283 | Open in IMG/M |
3300021432|Ga0210384_10018945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6682 | Open in IMG/M |
3300021477|Ga0210398_10007494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9901 | Open in IMG/M |
3300021560|Ga0126371_10227764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1971 | Open in IMG/M |
3300025906|Ga0207699_11243222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300025921|Ga0207652_10193181 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
3300026215|Ga0209849_1052349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300026301|Ga0209238_1274587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300026329|Ga0209375_1031856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2831 | Open in IMG/M |
3300026524|Ga0209690_1224968 | Not Available | 590 | Open in IMG/M |
3300026532|Ga0209160_1039084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2882 | Open in IMG/M |
3300026552|Ga0209577_10678626 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300027570|Ga0208043_1013963 | All Organisms → cellular organisms → Bacteria | 2638 | Open in IMG/M |
3300027853|Ga0209274_10626235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300027894|Ga0209068_10462862 | Not Available | 728 | Open in IMG/M |
3300028866|Ga0302278_10151213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
3300029989|Ga0311365_10075409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2875 | Open in IMG/M |
3300029999|Ga0311339_10594700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
3300030003|Ga0302172_10151955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300030007|Ga0311338_11966328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300030019|Ga0311348_10857262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300030399|Ga0311353_10011920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10199 | Open in IMG/M |
3300030491|Ga0302211_10051677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
3300030503|Ga0311370_10654913 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300030862|Ga0265753_1104217 | Not Available | 578 | Open in IMG/M |
3300031057|Ga0170834_100050311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300031232|Ga0302323_100278529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1725 | Open in IMG/M |
3300031681|Ga0318572_10449658 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300031715|Ga0307476_10481209 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300031726|Ga0302321_100872473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
3300031754|Ga0307475_11424419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300031823|Ga0307478_11144978 | Not Available | 649 | Open in IMG/M |
3300031910|Ga0306923_10376717 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300031996|Ga0308176_10850044 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300032805|Ga0335078_12534046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300032828|Ga0335080_10223029 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300032828|Ga0335080_11852144 | Not Available | 588 | Open in IMG/M |
3300032892|Ga0335081_10318170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
3300032955|Ga0335076_10810206 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300033134|Ga0335073_11780125 | Not Available | 577 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.04% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.04% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.20% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.20% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.36% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.68% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.84% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_123740132 | 3300000789 | Soil | IMMVPSDGKFFFANDVLRSMNMANHSSQADPPVDPQN* |
JGI12636J13339_10003601 | 3300001154 | Forest Soil | IMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK* |
JGI12269J14319_100233004 | 3300001356 | Peatlands Soil | KLQIMMVPADGKFFFANDVLRSMSAANQASQTEPAEQPR* |
JGI12712J15308_102021882 | 3300001471 | Forest Soil | KLQIMMVPADGKFFFANDVIRGMNLANQNTQAEPQSR* |
C688J18823_100115383 | 3300001686 | Soil | MMVPSDGKYFFANDVLKSMNMANKNSEAEQGEEK* |
JGI25382J37095_100165721 | 3300002562 | Grasslands Soil | LQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0066674_104452051 | 3300005166 | Soil | QIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0066673_104155732 | 3300005175 | Soil | LQIMMVPSDGKFFFANDVLKSMNMANRGSQADQAEEPEK* |
Ga0070690_1013554391 | 3300005330 | Switchgrass Rhizosphere | DKLQIMMVPADGKFFFANDVLKSMNMANRSSEADQTQEK* |
Ga0070709_116521491 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIMMVPADGKFFFANDVLRSMTTANQAAQAQEPEPAPQN* |
Ga0070714_1019427151 | 3300005435 | Agricultural Soil | DKLQIMMVPSDGKFFFANDVLRSMNMANHGSQAEPPEDSQDK* |
Ga0070713_1009963792 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KLQIMMVPADGKFFFANDVLRSMNMTNQAGQAEQPQEQQR* |
Ga0070730_108165361 | 3300005537 | Surface Soil | QIMMVPADGKFFMNDVLRSMNMGAGAGAQEPTEEQQR* |
Ga0070733_111113101 | 3300005541 | Surface Soil | RLSDKLQIMMVPADGKFFMNDVLKSMNLANPAGSAGDQQR* |
Ga0070732_101562511 | 3300005542 | Surface Soil | DKLQIMMVPSDGKFFFANDMLKSMNMANKGSEADQAEEK* |
Ga0070732_102429782 | 3300005542 | Surface Soil | LSDKLQIMMVPADVKFFMNDVLKSMNMAQAATQPEPQEEQQR* |
Ga0070732_103356322 | 3300005542 | Surface Soil | IMMVPADGKFFFANDVLRSMSVANQAGQAERTEEQPR* |
Ga0066661_107533401 | 3300005554 | Soil | MVPADGKFFFANDVLRSMNVANHTSQAEQPEDPPQR* |
Ga0066700_110626542 | 3300005559 | Soil | IMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0068855_1009583152 | 3300005563 | Corn Rhizosphere | MMVPSDGKYFFANDVLKSMNMANKNSESDQGEEK* |
Ga0066693_101239501 | 3300005566 | Soil | SDKLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0066694_104886902 | 3300005574 | Soil | PADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0070761_103038721 | 3300005591 | Soil | QIMMVPADGKFFFANDVLHSMSAATQAEQGEAQPR* |
Ga0070764_100926312 | 3300005712 | Soil | SDKLQIMMVPADGKIFFNDILHGMNTGNSASQAEGAAAEGNAQQ* |
Ga0070764_108910281 | 3300005712 | Soil | QIMMVPADGKFFFANDVLRSMNVANQSGQAEQQR* |
Ga0068863_1001723361 | 3300005841 | Switchgrass Rhizosphere | DKLQIMMVPSDGKFFFANDVLKSMNMANRGSEAEQGEEK* |
Ga0080027_102205752 | 3300005993 | Prmafrost Soil | DKLQIMMVPADGKFFFANDVLRGMNMAAQTGQGESPQGPQAR* |
Ga0066696_105155661 | 3300006032 | Soil | QIMMVPADGKFFFANDVLRSMNMANRTSQTEDAGEQGPPQR* |
Ga0075028_1006282391 | 3300006050 | Watersheds | VPADGKFFFANDVLRSMSVANHSSEAEEPEMQQPK* |
Ga0075017_1001083271 | 3300006059 | Watersheds | AERLSDKLQIMMVPADGKFFMNDVLRSMNMGNAASPTEPPEEQR* |
Ga0075015_1007935731 | 3300006102 | Watersheds | SDKLQIMMVPADGKFFFTNDVLRGMNPANHVSQVEGAAEPAEANEK* |
Ga0075030_1016389861 | 3300006162 | Watersheds | QIMMVPADGKFFFANDVMKSMTANHMTQSEVAEEPEKR* |
Ga0070765_1017572151 | 3300006176 | Soil | QIMMVPADGKFFFANDVLRGMDVASQGKQAERQTR* |
Ga0070765_1019286862 | 3300006176 | Soil | LQIMMVPADGKFFFANDVLRSMSVSNHVADAEQPEEQPK* |
Ga0066710_1047065512 | 3300009012 | Grasslands Soil | QIMMVPADGKFFFANDVLRSMNMANHTSQAEQPEDPPQR |
Ga0116128_11337941 | 3300009518 | Peatland | IMMVPADGKFFFANDVLRSMSAANQASQAERPEEQPR* |
Ga0116214_14394911 | 3300009520 | Peatlands Soil | VAERLSDKLQIMMVPADGKFFMNDVLRSMNVGGAASQAEPPEEQR* |
Ga0116133_11421401 | 3300009623 | Peatland | LQIMMVPADGKFFFANDVLRSMSVAGQGAQTEQR* |
Ga0116223_102361841 | 3300009839 | Peatlands Soil | IMMVPSDGKFFFTNDVLRSMSTANHASQAQDAEAPPQN* |
Ga0126370_122156882 | 3300010358 | Tropical Forest Soil | RLSDKLQIMMVPADGKFFMNDVLKSMNMGAPSAPAEQGEEQQR* |
Ga0126377_103237002 | 3300010362 | Tropical Forest Soil | IMMVPADGKFFFANDVLRSMNTANHVSQAELEEQPQDPPQH* |
Ga0134126_119098431 | 3300010396 | Terrestrial Soil | LQIMMVPADGKFFFANDVLKSMNMANRTSEVDQTEEK* |
Ga0137393_114242301 | 3300011271 | Vadose Zone Soil | QIMMVPSDGKFFFANDVLKSMNMSNHASEADPTEEPEK* |
Ga0137382_112662631 | 3300012200 | Vadose Zone Soil | KLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0137376_115715211 | 3300012208 | Vadose Zone Soil | QIMMVPADGKFFFTNDVMRGMNTANHVSQADDAGAEK* |
Ga0137377_106099271 | 3300012211 | Vadose Zone Soil | IMMVPSDGKFFFANDVLKSLNMSNHGSEVDQAEGTEK* |
Ga0137387_105752571 | 3300012349 | Vadose Zone Soil | MVPSDGKFFFANDVLRSMNVANHSSQAEPDPQDK* |
Ga0137361_105687901 | 3300012362 | Vadose Zone Soil | SDKLQIMMVPADGKFFFANDVLRGMNMASQNAQTEQQPR* |
Ga0137397_107797282 | 3300012685 | Vadose Zone Soil | MMVPADGKFFFANDVLRSMNTANHVSLAEPEDPQDPK* |
Ga0137419_100042031 | 3300012925 | Vadose Zone Soil | IMMVPADGKFFFANDVLRSMSVGNQSSQVEQAEPQTR* |
Ga0164304_114620801 | 3300012986 | Soil | KLQIMMVPADGKFFFANDVLRSMNTANHVSQAGDPEDAPKQ* |
Ga0164305_107530031 | 3300012989 | Soil | VPADGKFFFANDVLRSMSMANHAGQAQDAGVDPPSN* |
Ga0163162_114892742 | 3300013306 | Switchgrass Rhizosphere | DKLQIMMVPADGKFFFANDVLKSMNMANRTSEVDQTEEK* |
Ga0134075_103311982 | 3300014154 | Grasslands Soil | MVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK* |
Ga0181518_105382801 | 3300014156 | Bog | MVPADGKFFFANDVLRSAPMTMATKPVEPDDDPR* |
Ga0181528_106502122 | 3300014167 | Bog | DKLQIMMVPADGKFFFANDVLKGLNIASSQAESQSR* |
Ga0132256_1029430521 | 3300015372 | Arabidopsis Rhizosphere | IMMVPSDGKFFFANDVLRSMNMANHTSQAEVPEEP* |
Ga0187801_101168151 | 3300017933 | Freshwater Sediment | DKLQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDAQQPK |
Ga0187821_101278372 | 3300017936 | Freshwater Sediment | DKLQIMMVPADGKFFFANDVLHSMNMANQASQSAQTEEQPR |
Ga0187785_100186363 | 3300017947 | Tropical Peatland | MMVPADGKFFFANDVLRSMNMANHGSQAEEPDDGQPK |
Ga0187780_105565262 | 3300017973 | Tropical Peatland | VPADGKFFFANDVLRSMNMANHAGQAEEPEEQQPK |
Ga0187782_101067011 | 3300017975 | Tropical Peatland | ERLSDKLQIMMVPADGKFFMNDVLKSMNMGNTATSQGEEQQR |
Ga0187782_106180751 | 3300017975 | Tropical Peatland | LQIMMVPADGKFFFANDVLRSMNMANQSSQSSQAETQEEQPR |
Ga0187822_100815601 | 3300017994 | Freshwater Sediment | DKLQIMMVPADGKFFFANDVLRSMNVANHSSQAEQPEDPADK |
Ga0187810_104832552 | 3300018012 | Freshwater Sediment | LQIMMVPADGKFFFANDVLRSMNAANHASQAEEPEDQQPK |
Ga0187873_13309621 | 3300018013 | Peatland | IMMVPADGKFFFANDVLRSMSAANQASQAERPEEQPR |
Ga0187855_104649582 | 3300018038 | Peatland | LQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK |
Ga0187887_101307683 | 3300018043 | Peatland | QIMMVPADGKFFFANDVLRSMSVANHTSQAEEPDEQQPK |
Ga0187784_111466321 | 3300018062 | Tropical Peatland | ADGKFFFANDVLRSMNMANQSSQSSQAETQEEQPR |
Ga0187771_113678742 | 3300018088 | Tropical Peatland | SDKLQIMMVPADGKFFFANDVLRSMNMANQAGQTEPPEEQPR |
Ga0066669_100210565 | 3300018482 | Grasslands Soil | DKLQIMMVPADGKFFFANDVLHSMNMANQASQSEQGEAQPH |
Ga0066669_113324251 | 3300018482 | Grasslands Soil | SDKLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK |
Ga0193721_10163631 | 3300020018 | Soil | QIMMVPSDGKFFFANDVLKSMNMANQGSQSEQVEGEK |
Ga0187768_11147662 | 3300020150 | Tropical Peatland | IMMVPADGKFFFANDVLRSMNMANRGSQAEEAEPK |
Ga0210405_103371611 | 3300021171 | Soil | IVMVPADGKFCFANDVLRSMSVANHSGQADAAEEPQQK |
Ga0210388_115393172 | 3300021181 | Soil | KLQIMMVPADGKFFFANDVLRSISVAGQSGQAETR |
Ga0210386_100305034 | 3300021406 | Soil | MMVPADGKFFFANDVLRSMSVANHASQAEEPDGQQPK |
Ga0210386_106726052 | 3300021406 | Soil | VPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK |
Ga0210386_108469132 | 3300021406 | Soil | LQIMMVPSDGKFFMNDVLKSMNMPSAAGAAGQTEEQTR |
Ga0210383_103449761 | 3300021407 | Soil | DKLQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK |
Ga0210384_100189451 | 3300021432 | Soil | IMMVPADGKFFFANDVLRSVNMANHGSQAEQPDDSQDK |
Ga0210398_100074949 | 3300021477 | Soil | KLQIMMVPADGKFFFANDVLHSMSAANQASQAEEPR |
Ga0126371_102277642 | 3300021560 | Tropical Forest Soil | MMVPSDGKFFFANDVLRSMNMANHSSQAEQPEDPQDK |
Ga0207699_112432222 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LQIMMVPADGKFFFANDVLRSMNVANQASQSEQSGEQQR |
Ga0207652_101931813 | 3300025921 | Corn Rhizosphere | QIMMVPADGKFFFANDVLKSMNMANRSSEADQTQEK |
Ga0209849_10523492 | 3300026215 | Soil | ERLSDKLQIMMVPSDSKVFFANDVLRGMNVANRAVQADEAEATQK |
Ga0209238_12745872 | 3300026301 | Grasslands Soil | LQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK |
Ga0209375_10318561 | 3300026329 | Soil | MMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK |
Ga0209690_12249682 | 3300026524 | Soil | MVPSDGKFFFANDVLRSMNMANRTSQAEEPEEAPQK |
Ga0209160_10390842 | 3300026532 | Soil | MMVPADGKFFFANDVLRSMNVANQASQAEPQEGQTR |
Ga0209577_106786262 | 3300026552 | Soil | DKLQIMMVPADGKFFFANDVLRSMSMANRSSQAEDAQDPH |
Ga0208043_10139631 | 3300027570 | Peatlands Soil | MVPADGKFFFANDVLRSMSVANHASQAEESDEQQPK |
Ga0209274_106262352 | 3300027853 | Soil | LSDKLQIMMVPADGKFFFANDVLRGMNMANQNGQAEQR |
Ga0209068_104628621 | 3300027894 | Watersheds | IMMVPADGKFFFTNDVMKSMSAGRVSQSDEAEDPAGSQK |
Ga0302278_101512132 | 3300028866 | Bog | SDKLQIMMVPADGKFFFANDVLRGMSAASEGGQTEQR |
Ga0311365_100754091 | 3300029989 | Fen | MVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR |
Ga0311339_105947001 | 3300029999 | Palsa | SDKLQIMMVPADGKFFFANDVLRGMDLASQGKQPEQRR |
Ga0302172_101519552 | 3300030003 | Fen | LQIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR |
Ga0311338_119663281 | 3300030007 | Palsa | SDKLQIMMVPADGKFFFANDVLRGMGVANQSGQAEQR |
Ga0311348_108572622 | 3300030019 | Fen | DKLQIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR |
Ga0311353_100119201 | 3300030399 | Palsa | DKLQIMMVPADGKFFFANDVLRGMGVANQSGQAEQR |
Ga0302211_100516772 | 3300030491 | Fen | QIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR |
Ga0311370_106549131 | 3300030503 | Palsa | QIMMVPADGKFFFANDVLRGMSAVGQAAQTEPDQPR |
Ga0265753_11042172 | 3300030862 | Soil | VPADGKFFFANDVLRSMSVANHASQAEGSDEQQPK |
Ga0170834_1000503111 | 3300031057 | Forest Soil | LQIMMVPADGKFFFANDVLRGMNLANQSAQTEPQPR |
Ga0302323_1002785293 | 3300031232 | Fen | RLSDKLQIMMVPADGKIFFTNDVLRGMNPANHASQAEDADPTESAKR |
Ga0318572_104496582 | 3300031681 | Soil | LQIMMVPADGKFFFANDVLHSMNMANHSSQAGDAETK |
Ga0307476_104812092 | 3300031715 | Hardwood Forest Soil | SDKLQIMMVPADGKFFFANDVLRSMSVANQAGQVEEPR |
Ga0302321_1008724731 | 3300031726 | Fen | MMVPADGKFFFTNDVLRGMNTANHVSQAEDAGEEKQ |
Ga0307475_114244192 | 3300031754 | Hardwood Forest Soil | SDKLQIMMVPADGKFFFASDVLRGMNLANQSAQTEPQPR |
Ga0307478_111449781 | 3300031823 | Hardwood Forest Soil | LQIMMVPADGKFFFANDVLRSMSMANQSGQAEPQAR |
Ga0306923_103767171 | 3300031910 | Soil | VPSDGKFFFANDVLRSMNMTNHASQAEAPEDPQDK |
Ga0308176_108500441 | 3300031996 | Soil | QIMMVPADGKFFFANDVLRSMNVANHASQAEQGEEQPH |
Ga0335078_125340462 | 3300032805 | Soil | IMMVPSDGKFFFANDVLRSMNMANHSSQAEPEDPQDK |
Ga0335080_102230291 | 3300032828 | Soil | KLQIMMVPADGKFFFANDVLRSMNVANHASQAQDAEGPPQN |
Ga0335080_118521442 | 3300032828 | Soil | IMMVPSDGKFFFANDVLRSMNMANQNTQAEQPEDQK |
Ga0335081_103181701 | 3300032892 | Soil | IMMVPADGKFFFANDVLRSMNMANRSSQAEEAEPK |
Ga0335076_108102062 | 3300032955 | Soil | MMVPADGKFFMNDVLRSMNLGAAGSQPAQAEDQQQ |
Ga0335073_117801252 | 3300033134 | Soil | IMMVPADGKFFFANDVLRSMSAGSQATQSEQAEPQSR |
⦗Top⦘ |