NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075099

Metagenome / Metatranscriptome Family F075099

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075099
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 38 residues
Representative Sequence LQIMMVPADGKFFFANDVLRSMNAANHASQAEEPEDQQPK
Number of Associated Samples 110
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.84 %
% of genes near scaffold ends (potentially truncated) 95.80 %
% of genes from short scaffolds (< 2000 bps) 84.03 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.555 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(9.244 % of family members)
Environment Ontology (ENVO) Unclassified
(15.966 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.782 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.47%    β-sheet: 0.00%    Coil/Unstructured: 73.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00496SBP_bac_5 12.61
PF01145Band_7 1.68
PF02012BNR 0.84
PF00848Ring_hydroxyl_A 0.84
PF02129Peptidase_S15 0.84
PF00440TetR_N 0.84
PF00128Alpha-amylase 0.84
PF02518HATPase_c 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.68
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.84
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.84
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.84
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.55 %
UnclassifiedrootN/A13.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12374013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis784Open in IMG/M
3300001154|JGI12636J13339_1000360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7573Open in IMG/M
3300001356|JGI12269J14319_10023300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4335Open in IMG/M
3300001471|JGI12712J15308_10202188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis522Open in IMG/M
3300001686|C688J18823_10011538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5806Open in IMG/M
3300002562|JGI25382J37095_10016572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2825Open in IMG/M
3300005166|Ga0066674_10445205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter592Open in IMG/M
3300005175|Ga0066673_10415573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter787Open in IMG/M
3300005330|Ga0070690_101355439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter571Open in IMG/M
3300005434|Ga0070709_11652149All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300005435|Ga0070714_101942715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter574Open in IMG/M
3300005436|Ga0070713_100996379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter808Open in IMG/M
3300005537|Ga0070730_10816536Not Available587Open in IMG/M
3300005541|Ga0070733_11111310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300005542|Ga0070732_10156251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1358Open in IMG/M
3300005542|Ga0070732_10242978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1078Open in IMG/M
3300005542|Ga0070732_10335632All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter909Open in IMG/M
3300005554|Ga0066661_10753340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter570Open in IMG/M
3300005559|Ga0066700_11062654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter530Open in IMG/M
3300005563|Ga0068855_100958315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter901Open in IMG/M
3300005566|Ga0066693_10123950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter952Open in IMG/M
3300005574|Ga0066694_10488690Not Available574Open in IMG/M
3300005591|Ga0070761_10303872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter961Open in IMG/M
3300005712|Ga0070764_10092631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1605Open in IMG/M
3300005712|Ga0070764_10891028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter557Open in IMG/M
3300005841|Ga0068863_100172336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2076Open in IMG/M
3300005993|Ga0080027_10220575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter743Open in IMG/M
3300006032|Ga0066696_10515566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300006050|Ga0075028_100628239All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300006059|Ga0075017_100108327All Organisms → cellular organisms → Bacteria → Acidobacteria1942Open in IMG/M
3300006102|Ga0075015_100793573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300006162|Ga0075030_101638986Not Available503Open in IMG/M
3300006176|Ga0070765_101757215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300006176|Ga0070765_101928686All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300009012|Ga0066710_104706551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300009518|Ga0116128_1133794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300009520|Ga0116214_1439491All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300009623|Ga0116133_1142140Not Available626Open in IMG/M
3300009839|Ga0116223_10236184All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300010358|Ga0126370_12215688Not Available542Open in IMG/M
3300010362|Ga0126377_10323700All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300010396|Ga0134126_11909843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300011271|Ga0137393_11424230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300012200|Ga0137382_11266263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300012208|Ga0137376_11571521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300012211|Ga0137377_10609927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1028Open in IMG/M
3300012349|Ga0137387_10575257All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300012362|Ga0137361_10568790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1039Open in IMG/M
3300012685|Ga0137397_10779728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300012925|Ga0137419_10004203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7018Open in IMG/M
3300012986|Ga0164304_11462080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300012989|Ga0164305_10753003Not Available802Open in IMG/M
3300013306|Ga0163162_11489274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300014154|Ga0134075_10331198All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300014156|Ga0181518_10538280Not Available549Open in IMG/M
3300014167|Ga0181528_10650212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300015372|Ga0132256_102943052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300017933|Ga0187801_10116815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1022Open in IMG/M
3300017936|Ga0187821_10127837All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300017947|Ga0187785_10018636All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300017973|Ga0187780_10556526All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300017975|Ga0187782_10106701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2063Open in IMG/M
3300017975|Ga0187782_10618075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300017994|Ga0187822_10081560All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300018012|Ga0187810_10483255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300018013|Ga0187873_1330962Not Available557Open in IMG/M
3300018038|Ga0187855_10464958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300018043|Ga0187887_10130768All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300018062|Ga0187784_11146632Not Available617Open in IMG/M
3300018088|Ga0187771_11367874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300018482|Ga0066669_10021056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3649Open in IMG/M
3300018482|Ga0066669_11332425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300020018|Ga0193721_1016363All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300020150|Ga0187768_1114766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300021171|Ga0210405_10337161All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300021181|Ga0210388_11539317Not Available554Open in IMG/M
3300021406|Ga0210386_10030503All Organisms → cellular organisms → Bacteria → Acidobacteria4229Open in IMG/M
3300021406|Ga0210386_10672605All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300021406|Ga0210386_10846913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300021407|Ga0210383_10344976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1283Open in IMG/M
3300021432|Ga0210384_10018945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6682Open in IMG/M
3300021477|Ga0210398_10007494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9901Open in IMG/M
3300021560|Ga0126371_10227764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1971Open in IMG/M
3300025906|Ga0207699_11243222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300025921|Ga0207652_10193181All Organisms → cellular organisms → Bacteria1831Open in IMG/M
3300026215|Ga0209849_1052349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300026301|Ga0209238_1274587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300026329|Ga0209375_1031856All Organisms → cellular organisms → Bacteria → Acidobacteria2831Open in IMG/M
3300026524|Ga0209690_1224968Not Available590Open in IMG/M
3300026532|Ga0209160_1039084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2882Open in IMG/M
3300026552|Ga0209577_10678626All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300027570|Ga0208043_1013963All Organisms → cellular organisms → Bacteria2638Open in IMG/M
3300027853|Ga0209274_10626235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300027894|Ga0209068_10462862Not Available728Open in IMG/M
3300028866|Ga0302278_10151213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1210Open in IMG/M
3300029989|Ga0311365_10075409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2875Open in IMG/M
3300029999|Ga0311339_10594700All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1103Open in IMG/M
3300030003|Ga0302172_10151955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300030007|Ga0311338_11966328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300030019|Ga0311348_10857262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300030399|Ga0311353_10011920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis10199Open in IMG/M
3300030491|Ga0302211_10051677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1173Open in IMG/M
3300030503|Ga0311370_10654913All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300030862|Ga0265753_1104217Not Available578Open in IMG/M
3300031057|Ga0170834_100050311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300031232|Ga0302323_100278529All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1725Open in IMG/M
3300031681|Ga0318572_10449658All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300031715|Ga0307476_10481209All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300031726|Ga0302321_100872473All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300031754|Ga0307475_11424419All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300031823|Ga0307478_11144978Not Available649Open in IMG/M
3300031910|Ga0306923_10376717All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300031996|Ga0308176_10850044All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300032805|Ga0335078_12534046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300032828|Ga0335080_10223029All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300032828|Ga0335080_11852144Not Available588Open in IMG/M
3300032892|Ga0335081_10318170All Organisms → cellular organisms → Bacteria → Acidobacteria2049Open in IMG/M
3300032955|Ga0335076_10810206All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300033134|Ga0335073_11780125Not Available577Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.04%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.04%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.20%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.36%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.36%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.84%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026215Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1237401323300000789SoilIMMVPSDGKFFFANDVLRSMNMANHSSQADPPVDPQN*
JGI12636J13339_100036013300001154Forest SoilIMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK*
JGI12269J14319_1002330043300001356Peatlands SoilKLQIMMVPADGKFFFANDVLRSMSAANQASQTEPAEQPR*
JGI12712J15308_1020218823300001471Forest SoilKLQIMMVPADGKFFFANDVIRGMNLANQNTQAEPQSR*
C688J18823_1001153833300001686SoilMMVPSDGKYFFANDVLKSMNMANKNSEAEQGEEK*
JGI25382J37095_1001657213300002562Grasslands SoilLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0066674_1044520513300005166SoilQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0066673_1041557323300005175SoilLQIMMVPSDGKFFFANDVLKSMNMANRGSQADQAEEPEK*
Ga0070690_10135543913300005330Switchgrass RhizosphereDKLQIMMVPADGKFFFANDVLKSMNMANRSSEADQTQEK*
Ga0070709_1165214913300005434Corn, Switchgrass And Miscanthus RhizosphereLQIMMVPADGKFFFANDVLRSMTTANQAAQAQEPEPAPQN*
Ga0070714_10194271513300005435Agricultural SoilDKLQIMMVPSDGKFFFANDVLRSMNMANHGSQAEPPEDSQDK*
Ga0070713_10099637923300005436Corn, Switchgrass And Miscanthus RhizosphereKLQIMMVPADGKFFFANDVLRSMNMTNQAGQAEQPQEQQR*
Ga0070730_1081653613300005537Surface SoilQIMMVPADGKFFMNDVLRSMNMGAGAGAQEPTEEQQR*
Ga0070733_1111131013300005541Surface SoilRLSDKLQIMMVPADGKFFMNDVLKSMNLANPAGSAGDQQR*
Ga0070732_1015625113300005542Surface SoilDKLQIMMVPSDGKFFFANDMLKSMNMANKGSEADQAEEK*
Ga0070732_1024297823300005542Surface SoilLSDKLQIMMVPADVKFFMNDVLKSMNMAQAATQPEPQEEQQR*
Ga0070732_1033563223300005542Surface SoilIMMVPADGKFFFANDVLRSMSVANQAGQAERTEEQPR*
Ga0066661_1075334013300005554SoilMVPADGKFFFANDVLRSMNVANHTSQAEQPEDPPQR*
Ga0066700_1106265423300005559SoilIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0068855_10095831523300005563Corn RhizosphereMMVPSDGKYFFANDVLKSMNMANKNSESDQGEEK*
Ga0066693_1012395013300005566SoilSDKLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0066694_1048869023300005574SoilPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0070761_1030387213300005591SoilQIMMVPADGKFFFANDVLHSMSAATQAEQGEAQPR*
Ga0070764_1009263123300005712SoilSDKLQIMMVPADGKIFFNDILHGMNTGNSASQAEGAAAEGNAQQ*
Ga0070764_1089102813300005712SoilQIMMVPADGKFFFANDVLRSMNVANQSGQAEQQR*
Ga0068863_10017233613300005841Switchgrass RhizosphereDKLQIMMVPSDGKFFFANDVLKSMNMANRGSEAEQGEEK*
Ga0080027_1022057523300005993Prmafrost SoilDKLQIMMVPADGKFFFANDVLRGMNMAAQTGQGESPQGPQAR*
Ga0066696_1051556613300006032SoilQIMMVPADGKFFFANDVLRSMNMANRTSQTEDAGEQGPPQR*
Ga0075028_10062823913300006050WatershedsVPADGKFFFANDVLRSMSVANHSSEAEEPEMQQPK*
Ga0075017_10010832713300006059WatershedsAERLSDKLQIMMVPADGKFFMNDVLRSMNMGNAASPTEPPEEQR*
Ga0075015_10079357313300006102WatershedsSDKLQIMMVPADGKFFFTNDVLRGMNPANHVSQVEGAAEPAEANEK*
Ga0075030_10163898613300006162WatershedsQIMMVPADGKFFFANDVMKSMTANHMTQSEVAEEPEKR*
Ga0070765_10175721513300006176SoilQIMMVPADGKFFFANDVLRGMDVASQGKQAERQTR*
Ga0070765_10192868623300006176SoilLQIMMVPADGKFFFANDVLRSMSVSNHVADAEQPEEQPK*
Ga0066710_10470655123300009012Grasslands SoilQIMMVPADGKFFFANDVLRSMNMANHTSQAEQPEDPPQR
Ga0116128_113379413300009518PeatlandIMMVPADGKFFFANDVLRSMSAANQASQAERPEEQPR*
Ga0116214_143949113300009520Peatlands SoilVAERLSDKLQIMMVPADGKFFMNDVLRSMNVGGAASQAEPPEEQR*
Ga0116133_114214013300009623PeatlandLQIMMVPADGKFFFANDVLRSMSVAGQGAQTEQR*
Ga0116223_1023618413300009839Peatlands SoilIMMVPSDGKFFFTNDVLRSMSTANHASQAQDAEAPPQN*
Ga0126370_1221568823300010358Tropical Forest SoilRLSDKLQIMMVPADGKFFMNDVLKSMNMGAPSAPAEQGEEQQR*
Ga0126377_1032370023300010362Tropical Forest SoilIMMVPADGKFFFANDVLRSMNTANHVSQAELEEQPQDPPQH*
Ga0134126_1190984313300010396Terrestrial SoilLQIMMVPADGKFFFANDVLKSMNMANRTSEVDQTEEK*
Ga0137393_1142423013300011271Vadose Zone SoilQIMMVPSDGKFFFANDVLKSMNMSNHASEADPTEEPEK*
Ga0137382_1126626313300012200Vadose Zone SoilKLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0137376_1157152113300012208Vadose Zone SoilQIMMVPADGKFFFTNDVMRGMNTANHVSQADDAGAEK*
Ga0137377_1060992713300012211Vadose Zone SoilIMMVPSDGKFFFANDVLKSLNMSNHGSEVDQAEGTEK*
Ga0137387_1057525713300012349Vadose Zone SoilMVPSDGKFFFANDVLRSMNVANHSSQAEPDPQDK*
Ga0137361_1056879013300012362Vadose Zone SoilSDKLQIMMVPADGKFFFANDVLRGMNMASQNAQTEQQPR*
Ga0137397_1077972823300012685Vadose Zone SoilMMVPADGKFFFANDVLRSMNTANHVSLAEPEDPQDPK*
Ga0137419_1000420313300012925Vadose Zone SoilIMMVPADGKFFFANDVLRSMSVGNQSSQVEQAEPQTR*
Ga0164304_1146208013300012986SoilKLQIMMVPADGKFFFANDVLRSMNTANHVSQAGDPEDAPKQ*
Ga0164305_1075300313300012989SoilVPADGKFFFANDVLRSMSMANHAGQAQDAGVDPPSN*
Ga0163162_1148927423300013306Switchgrass RhizosphereDKLQIMMVPADGKFFFANDVLKSMNMANRTSEVDQTEEK*
Ga0134075_1033119823300014154Grasslands SoilMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK*
Ga0181518_1053828013300014156BogMVPADGKFFFANDVLRSAPMTMATKPVEPDDDPR*
Ga0181528_1065021223300014167BogDKLQIMMVPADGKFFFANDVLKGLNIASSQAESQSR*
Ga0132256_10294305213300015372Arabidopsis RhizosphereIMMVPSDGKFFFANDVLRSMNMANHTSQAEVPEEP*
Ga0187801_1011681513300017933Freshwater SedimentDKLQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDAQQPK
Ga0187821_1012783723300017936Freshwater SedimentDKLQIMMVPADGKFFFANDVLHSMNMANQASQSAQTEEQPR
Ga0187785_1001863633300017947Tropical PeatlandMMVPADGKFFFANDVLRSMNMANHGSQAEEPDDGQPK
Ga0187780_1055652623300017973Tropical PeatlandVPADGKFFFANDVLRSMNMANHAGQAEEPEEQQPK
Ga0187782_1010670113300017975Tropical PeatlandERLSDKLQIMMVPADGKFFMNDVLKSMNMGNTATSQGEEQQR
Ga0187782_1061807513300017975Tropical PeatlandLQIMMVPADGKFFFANDVLRSMNMANQSSQSSQAETQEEQPR
Ga0187822_1008156013300017994Freshwater SedimentDKLQIMMVPADGKFFFANDVLRSMNVANHSSQAEQPEDPADK
Ga0187810_1048325523300018012Freshwater SedimentLQIMMVPADGKFFFANDVLRSMNAANHASQAEEPEDQQPK
Ga0187873_133096213300018013PeatlandIMMVPADGKFFFANDVLRSMSAANQASQAERPEEQPR
Ga0187855_1046495823300018038PeatlandLQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK
Ga0187887_1013076833300018043PeatlandQIMMVPADGKFFFANDVLRSMSVANHTSQAEEPDEQQPK
Ga0187784_1114663213300018062Tropical PeatlandADGKFFFANDVLRSMNMANQSSQSSQAETQEEQPR
Ga0187771_1136787423300018088Tropical PeatlandSDKLQIMMVPADGKFFFANDVLRSMNMANQAGQTEPPEEQPR
Ga0066669_1002105653300018482Grasslands SoilDKLQIMMVPADGKFFFANDVLHSMNMANQASQSEQGEAQPH
Ga0066669_1133242513300018482Grasslands SoilSDKLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK
Ga0193721_101636313300020018SoilQIMMVPSDGKFFFANDVLKSMNMANQGSQSEQVEGEK
Ga0187768_111476623300020150Tropical PeatlandIMMVPADGKFFFANDVLRSMNMANRGSQAEEAEPK
Ga0210405_1033716113300021171SoilIVMVPADGKFCFANDVLRSMSVANHSGQADAAEEPQQK
Ga0210388_1153931723300021181SoilKLQIMMVPADGKFFFANDVLRSISVAGQSGQAETR
Ga0210386_1003050343300021406SoilMMVPADGKFFFANDVLRSMSVANHASQAEEPDGQQPK
Ga0210386_1067260523300021406SoilVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK
Ga0210386_1084691323300021406SoilLQIMMVPSDGKFFMNDVLKSMNMPSAAGAAGQTEEQTR
Ga0210383_1034497613300021407SoilDKLQIMMVPADGKFFFANDVLRSMSVANHASQAEEPDEQQPK
Ga0210384_1001894513300021432SoilIMMVPADGKFFFANDVLRSVNMANHGSQAEQPDDSQDK
Ga0210398_1000749493300021477SoilKLQIMMVPADGKFFFANDVLHSMSAANQASQAEEPR
Ga0126371_1022776423300021560Tropical Forest SoilMMVPSDGKFFFANDVLRSMNMANHSSQAEQPEDPQDK
Ga0207699_1124322223300025906Corn, Switchgrass And Miscanthus RhizosphereLQIMMVPADGKFFFANDVLRSMNVANQASQSEQSGEQQR
Ga0207652_1019318133300025921Corn RhizosphereQIMMVPADGKFFFANDVLKSMNMANRSSEADQTQEK
Ga0209849_105234923300026215SoilERLSDKLQIMMVPSDSKVFFANDVLRGMNVANRAVQADEAEATQK
Ga0209238_127458723300026301Grasslands SoilLQIMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK
Ga0209375_103185613300026329SoilMMVPADGKFFFANDVLRSMNMANRTSQAEEAQDPPEK
Ga0209690_122496823300026524SoilMVPSDGKFFFANDVLRSMNMANRTSQAEEPEEAPQK
Ga0209160_103908423300026532SoilMMVPADGKFFFANDVLRSMNVANQASQAEPQEGQTR
Ga0209577_1067862623300026552SoilDKLQIMMVPADGKFFFANDVLRSMSMANRSSQAEDAQDPH
Ga0208043_101396313300027570Peatlands SoilMVPADGKFFFANDVLRSMSVANHASQAEESDEQQPK
Ga0209274_1062623523300027853SoilLSDKLQIMMVPADGKFFFANDVLRGMNMANQNGQAEQR
Ga0209068_1046286213300027894WatershedsIMMVPADGKFFFTNDVMKSMSAGRVSQSDEAEDPAGSQK
Ga0302278_1015121323300028866BogSDKLQIMMVPADGKFFFANDVLRGMSAASEGGQTEQR
Ga0311365_1007540913300029989FenMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR
Ga0311339_1059470013300029999PalsaSDKLQIMMVPADGKFFFANDVLRGMDLASQGKQPEQRR
Ga0302172_1015195523300030003FenLQIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR
Ga0311338_1196632813300030007PalsaSDKLQIMMVPADGKFFFANDVLRGMGVANQSGQAEQR
Ga0311348_1085726223300030019FenDKLQIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR
Ga0311353_1001192013300030399PalsaDKLQIMMVPADGKFFFANDVLRGMGVANQSGQAEQR
Ga0302211_1005167723300030491FenQIMMVPADGKFFFTNDVLRGMNPANHASQAEDADPTESAKR
Ga0311370_1065491313300030503PalsaQIMMVPADGKFFFANDVLRGMSAVGQAAQTEPDQPR
Ga0265753_110421723300030862SoilVPADGKFFFANDVLRSMSVANHASQAEGSDEQQPK
Ga0170834_10005031113300031057Forest SoilLQIMMVPADGKFFFANDVLRGMNLANQSAQTEPQPR
Ga0302323_10027852933300031232FenRLSDKLQIMMVPADGKIFFTNDVLRGMNPANHASQAEDADPTESAKR
Ga0318572_1044965823300031681SoilLQIMMVPADGKFFFANDVLHSMNMANHSSQAGDAETK
Ga0307476_1048120923300031715Hardwood Forest SoilSDKLQIMMVPADGKFFFANDVLRSMSVANQAGQVEEPR
Ga0302321_10087247313300031726FenMMVPADGKFFFTNDVLRGMNTANHVSQAEDAGEEKQ
Ga0307475_1142441923300031754Hardwood Forest SoilSDKLQIMMVPADGKFFFASDVLRGMNLANQSAQTEPQPR
Ga0307478_1114497813300031823Hardwood Forest SoilLQIMMVPADGKFFFANDVLRSMSMANQSGQAEPQAR
Ga0306923_1037671713300031910SoilVPSDGKFFFANDVLRSMNMTNHASQAEAPEDPQDK
Ga0308176_1085004413300031996SoilQIMMVPADGKFFFANDVLRSMNVANHASQAEQGEEQPH
Ga0335078_1253404623300032805SoilIMMVPSDGKFFFANDVLRSMNMANHSSQAEPEDPQDK
Ga0335080_1022302913300032828SoilKLQIMMVPADGKFFFANDVLRSMNVANHASQAQDAEGPPQN
Ga0335080_1185214423300032828SoilIMMVPSDGKFFFANDVLRSMNMANQNTQAEQPEDQK
Ga0335081_1031817013300032892SoilIMMVPADGKFFFANDVLRSMNMANRSSQAEEAEPK
Ga0335076_1081020623300032955SoilMMVPADGKFFMNDVLRSMNLGAAGSQPAQAEDQQQ
Ga0335073_1178012523300033134SoilIMMVPADGKFFFANDVLRSMSAGSQATQSEQAEPQSR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.