


| Basic Information | |
|---|---|
| Family ID | F074904 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 39 residues |
| Representative Sequence | IMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 42.02 % |
| % of genes near scaffold ends (potentially truncated) | 63.87 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.546 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.210 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.437 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 83.78% β-sheet: 0.00% Coil/Unstructured: 16.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00386 | C1q | 0.84 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.55 % |
| All Organisms | root | All Organisms | 34.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10114554 | Not Available | 1079 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10231891 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10072155 | Not Available | 1399 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10075290 | Not Available | 1356 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10110249 | Not Available | 1016 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10127090 | Not Available | 910 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10162499 | Not Available | 752 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10018351 | Not Available | 3710 | Open in IMG/M |
| 3300001352|JGI20157J14317_10089804 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005747|Ga0076924_1064495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300006025|Ga0075474_10062551 | Not Available | 1240 | Open in IMG/M |
| 3300006026|Ga0075478_10003521 | Not Available | 5616 | Open in IMG/M |
| 3300006027|Ga0075462_10041886 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1464 | Open in IMG/M |
| 3300006027|Ga0075462_10238690 | Not Available | 540 | Open in IMG/M |
| 3300006405|Ga0075510_11046638 | Not Available | 1116 | Open in IMG/M |
| 3300006637|Ga0075461_10133269 | Not Available | 767 | Open in IMG/M |
| 3300006735|Ga0098038_1272968 | All Organisms → Viruses | 530 | Open in IMG/M |
| 3300006737|Ga0098037_1058348 | Not Available | 1380 | Open in IMG/M |
| 3300006737|Ga0098037_1081185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1138 | Open in IMG/M |
| 3300006737|Ga0098037_1189781 | Not Available | 676 | Open in IMG/M |
| 3300006749|Ga0098042_1018958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2040 | Open in IMG/M |
| 3300006749|Ga0098042_1088730 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300006749|Ga0098042_1143198 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 588 | Open in IMG/M |
| 3300006802|Ga0070749_10777525 | Not Available | 509 | Open in IMG/M |
| 3300006867|Ga0075476_10278239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 591 | Open in IMG/M |
| 3300006916|Ga0070750_10206554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 867 | Open in IMG/M |
| 3300006919|Ga0070746_10229628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 873 | Open in IMG/M |
| 3300006919|Ga0070746_10371116 | Not Available | 645 | Open in IMG/M |
| 3300006928|Ga0098041_1004425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 4917 | Open in IMG/M |
| 3300007344|Ga0070745_1350068 | Not Available | 518 | Open in IMG/M |
| 3300007346|Ga0070753_1160153 | Not Available | 849 | Open in IMG/M |
| 3300007538|Ga0099851_1212108 | Not Available | 702 | Open in IMG/M |
| 3300007540|Ga0099847_1161546 | Not Available | 663 | Open in IMG/M |
| 3300007640|Ga0070751_1254259 | Not Available | 666 | Open in IMG/M |
| 3300007725|Ga0102951_1083090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 915 | Open in IMG/M |
| 3300009000|Ga0102960_1366651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 509 | Open in IMG/M |
| 3300009074|Ga0115549_1173207 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 695 | Open in IMG/M |
| 3300009438|Ga0115559_1109208 | Not Available | 1068 | Open in IMG/M |
| 3300009440|Ga0115561_1396955 | Not Available | 505 | Open in IMG/M |
| 3300009496|Ga0115570_10017814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4315 | Open in IMG/M |
| 3300009496|Ga0115570_10151751 | Not Available | 1081 | Open in IMG/M |
| 3300009497|Ga0115569_10192074 | Not Available | 948 | Open in IMG/M |
| 3300009507|Ga0115572_10512783 | Not Available | 664 | Open in IMG/M |
| 3300009507|Ga0115572_10565422 | Not Available | 627 | Open in IMG/M |
| 3300010149|Ga0098049_1236992 | Not Available | 556 | Open in IMG/M |
| 3300010153|Ga0098059_1117112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1056 | Open in IMG/M |
| 3300011129|Ga0151672_123827 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300011252|Ga0151674_1027061 | Not Available | 4332 | Open in IMG/M |
| 3300011262|Ga0151668_1367243 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 514 | Open in IMG/M |
| 3300012936|Ga0163109_10230849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1357 | Open in IMG/M |
| 3300017714|Ga0181412_1041573 | Not Available | 1195 | Open in IMG/M |
| 3300017714|Ga0181412_1053444 | Not Available | 1019 | Open in IMG/M |
| 3300017717|Ga0181404_1027109 | Not Available | 1471 | Open in IMG/M |
| 3300017720|Ga0181383_1207447 | Not Available | 519 | Open in IMG/M |
| 3300017725|Ga0181398_1024272 | Not Available | 1503 | Open in IMG/M |
| 3300017725|Ga0181398_1040245 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1140 | Open in IMG/M |
| 3300017727|Ga0181401_1105313 | Not Available | 715 | Open in IMG/M |
| 3300017729|Ga0181396_1021389 | Not Available | 1287 | Open in IMG/M |
| 3300017730|Ga0181417_1001217 | Not Available | 7835 | Open in IMG/M |
| 3300017732|Ga0181415_1050527 | Not Available | 946 | Open in IMG/M |
| 3300017755|Ga0181411_1071250 | Not Available | 1050 | Open in IMG/M |
| 3300017763|Ga0181410_1116737 | Not Available | 765 | Open in IMG/M |
| 3300017768|Ga0187220_1214829 | All Organisms → Viruses | 578 | Open in IMG/M |
| 3300017967|Ga0181590_10009324 | Not Available | 7997 | Open in IMG/M |
| 3300018049|Ga0181572_10529416 | Not Available | 723 | Open in IMG/M |
| 3300018416|Ga0181553_10286973 | Not Available | 920 | Open in IMG/M |
| 3300018416|Ga0181553_10287477 | Not Available | 919 | Open in IMG/M |
| 3300018416|Ga0181553_10301087 | Not Available | 893 | Open in IMG/M |
| 3300018420|Ga0181563_10193057 | Not Available | 1247 | Open in IMG/M |
| 3300018420|Ga0181563_10356302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 843 | Open in IMG/M |
| 3300018421|Ga0181592_10306134 | Not Available | 1148 | Open in IMG/M |
| 3300018424|Ga0181591_10429305 | Not Available | 978 | Open in IMG/M |
| 3300019459|Ga0181562_10382035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 684 | Open in IMG/M |
| 3300020053|Ga0181595_10402213 | Not Available | 530 | Open in IMG/M |
| 3300020166|Ga0206128_1315762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 551 | Open in IMG/M |
| 3300020185|Ga0206131_10070146 | Not Available | 2183 | Open in IMG/M |
| 3300020185|Ga0206131_10366088 | Not Available | 616 | Open in IMG/M |
| 3300020378|Ga0211527_10024121 | Not Available | 2070 | Open in IMG/M |
| 3300020438|Ga0211576_10075816 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1883 | Open in IMG/M |
| 3300021347|Ga0213862_10268503 | Not Available | 603 | Open in IMG/M |
| 3300021957|Ga0222717_10187372 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1236 | Open in IMG/M |
| 3300021958|Ga0222718_10030475 | Not Available | 3616 | Open in IMG/M |
| 3300021958|Ga0222718_10288232 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 857 | Open in IMG/M |
| 3300021959|Ga0222716_10755793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 509 | Open in IMG/M |
| 3300021960|Ga0222715_10182434 | Not Available | 1271 | Open in IMG/M |
| 3300022065|Ga0212024_1046357 | Not Available | 758 | Open in IMG/M |
| 3300022067|Ga0196895_1039656 | Not Available | 542 | Open in IMG/M |
| 3300022074|Ga0224906_1001777 | Not Available | 10329 | Open in IMG/M |
| 3300022074|Ga0224906_1175936 | Not Available | 593 | Open in IMG/M |
| 3300022168|Ga0212027_1028779 | Not Available | 740 | Open in IMG/M |
| 3300022183|Ga0196891_1024448 | Not Available | 1146 | Open in IMG/M |
| 3300022925|Ga0255773_10209387 | Not Available | 872 | Open in IMG/M |
| 3300022929|Ga0255752_10042429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 2937 | Open in IMG/M |
| 3300023116|Ga0255751_10069097 | Not Available | 2321 | Open in IMG/M |
| 3300024433|Ga0209986_10126926 | Not Available | 1349 | Open in IMG/M |
| 3300025086|Ga0208157_1085591 | Not Available | 780 | Open in IMG/M |
| 3300025101|Ga0208159_1046727 | Not Available | 912 | Open in IMG/M |
| 3300025102|Ga0208666_1100404 | All Organisms → Viruses | 714 | Open in IMG/M |
| 3300025127|Ga0209348_1017728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2709 | Open in IMG/M |
| 3300025128|Ga0208919_1082598 | Not Available | 1052 | Open in IMG/M |
| 3300025610|Ga0208149_1048680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1102 | Open in IMG/M |
| 3300025621|Ga0209504_1127239 | Not Available | 633 | Open in IMG/M |
| 3300025645|Ga0208643_1161660 | Not Available | 558 | Open in IMG/M |
| 3300025654|Ga0209196_1077613 | Not Available | 1032 | Open in IMG/M |
| 3300025671|Ga0208898_1064366 | Not Available | 1251 | Open in IMG/M |
| 3300025759|Ga0208899_1140148 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 842 | Open in IMG/M |
| 3300025769|Ga0208767_1208193 | Not Available | 650 | Open in IMG/M |
| 3300025810|Ga0208543_1160719 | Not Available | 523 | Open in IMG/M |
| 3300025828|Ga0208547_1158626 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 640 | Open in IMG/M |
| 3300025849|Ga0209603_1020153 | All Organisms → Viruses → Predicted Viral | 4238 | Open in IMG/M |
| 3300025880|Ga0209534_10226684 | Not Available | 912 | Open in IMG/M |
| 3300025894|Ga0209335_10363389 | Not Available | 596 | Open in IMG/M |
| 3300026187|Ga0209929_1131802 | Not Available | 624 | Open in IMG/M |
| 3300029318|Ga0185543_1076029 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 677 | Open in IMG/M |
| 3300031669|Ga0307375_10487346 | Not Available | 746 | Open in IMG/M |
| 3300032136|Ga0316201_11650769 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 529 | Open in IMG/M |
| 3300034374|Ga0348335_010328 | All Organisms → cellular organisms → Bacteria | 5175 | Open in IMG/M |
| 3300034374|Ga0348335_126784 | Not Available | 744 | Open in IMG/M |
| 3300034418|Ga0348337_091077 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Aequorivita → unclassified Aequorivita → Aequorivita sp. | 1027 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.21% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.61% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.61% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.76% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.24% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.20% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.52% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.52% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.68% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.84% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.84% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101145543 | 3300000101 | Marine | MDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| DelMOSum2010_102318912 | 3300000101 | Marine | MDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL* |
| DelMOSpr2010_100721552 | 3300000116 | Marine | IMDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| DelMOSpr2010_100752903 | 3300000116 | Marine | ITIMDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| DelMOSpr2010_101102492 | 3300000116 | Marine | RWWFRFTRRIIIMDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| DelMOSpr2010_101270902 | 3300000116 | Marine | KLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| DelMOSpr2010_101624992 | 3300000116 | Marine | MDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSIIS* |
| DelMOWin2010_100183512 | 3300000117 | Marine | MDKLNKIYYDIETKIKNKPTKYIIGLYVLLIVSIIL* |
| JGI20157J14317_100898042 | 3300001352 | Pelagic Marine | MDKLNKIYYDIETKIKNKPVKYIIGLYILLIVFIIL* |
| Ga0076924_10644952 | 3300005747 | Marine | MDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075474_100625512 | 3300006025 | Aqueous | IIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075478_100035215 | 3300006026 | Aqueous | MDKLKKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075462_100418862 | 3300006027 | Aqueous | WWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075462_102386902 | 3300006027 | Aqueous | MDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075510_110466382 | 3300006405 | Aqueous | MDKIRKIYYDIETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075461_101332692 | 3300006637 | Aqueous | IIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0098038_12729682 | 3300006735 | Marine | MDRIKKFYFDLEQKVKAKPTKHIIALYILFIISIIL* |
| Ga0098037_10583482 | 3300006737 | Marine | MDKLKKIYYDFETKVKAKPTKHIIALYILVIISIIL* |
| Ga0098037_10811851 | 3300006737 | Marine | RRFIIMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL* |
| Ga0098037_11897811 | 3300006737 | Marine | MDRIKKFYFDLEQKVRAKPTKHIIALYILFIISII |
| Ga0098042_10189582 | 3300006749 | Marine | MDKIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL* |
| Ga0098042_10887302 | 3300006749 | Marine | MDKIKKIYYDLETKVKAKPTKHIIALYILVIISLIS* |
| Ga0098042_11431981 | 3300006749 | Marine | IMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL* |
| Ga0070749_107775251 | 3300006802 | Aqueous | RRTIIMVKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0075476_102782391 | 3300006867 | Aqueous | IMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0070750_102065541 | 3300006916 | Aqueous | DKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0070746_102296281 | 3300006919 | Aqueous | RIIRRTIIMDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0070746_103711161 | 3300006919 | Aqueous | TIIMDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0098041_10044255 | 3300006928 | Marine | DRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL* |
| Ga0070745_13500682 | 3300007344 | Aqueous | IMDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| Ga0070753_11601532 | 3300007346 | Aqueous | WFRFTRRIIIMDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| Ga0099851_12121082 | 3300007538 | Aqueous | MDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIS* |
| Ga0099847_11615461 | 3300007540 | Aqueous | RCITWWWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0070751_12542591 | 3300007640 | Aqueous | KIRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0102951_10830902 | 3300007725 | Water | MNKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0102960_13666512 | 3300009000 | Pond Water | TWWWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0115549_11732072 | 3300009074 | Pelagic Marine | MDKLRKIYYDLETKVKAKPTKHIIALYVLVIISIIL* |
| Ga0115559_11092082 | 3300009438 | Pelagic Marine | TIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL* |
| Ga0115561_13969552 | 3300009440 | Pelagic Marine | RWWFRFTRRITLMDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL* |
| Ga0115570_100178141 | 3300009496 | Pelagic Marine | MDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSIIL* |
| Ga0115570_101517512 | 3300009496 | Pelagic Marine | RRITIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL* |
| Ga0115569_101920741 | 3300009497 | Pelagic Marine | MDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSII |
| Ga0115572_105127832 | 3300009507 | Pelagic Marine | IIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL* |
| Ga0115572_105654222 | 3300009507 | Pelagic Marine | DKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL* |
| Ga0098049_12369922 | 3300010149 | Marine | MDKIRKLIYDLETKVKAKPTKHIIALYILVIISIIL* |
| Ga0098059_11171122 | 3300010153 | Marine | MDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL* |
| Ga0151672_1238272 | 3300011129 | Marine | MDKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL* |
| Ga0151674_10270614 | 3300011252 | Marine | FRIIRRTVIMDKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL* |
| Ga0151668_13672432 | 3300011262 | Marine | MTRRFIIMDRIKKFYFDLEQKAREKPTKHIIALYILFIISII |
| Ga0163109_102308491 | 3300012936 | Surface Seawater | FRIIRRFIIMDKIKKIYYDLETKVKAKPTKHIIALYILVIISLIS* |
| Ga0181412_10415731 | 3300017714 | Seawater | ISWWWFRIIRRTIIMDKLKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181412_10534442 | 3300017714 | Seawater | WWFRIIRRIIIMDKLKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181404_10271091 | 3300017717 | Seawater | WWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181383_12074472 | 3300017720 | Seawater | FIIMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL |
| Ga0181398_10242722 | 3300017725 | Seawater | IRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181398_10402452 | 3300017725 | Seawater | MDKIKKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0181401_11053131 | 3300017727 | Seawater | RIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181396_10213891 | 3300017729 | Seawater | MDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIFF |
| Ga0181417_10012178 | 3300017730 | Seawater | MDRIKKFYFDLEQKVREKPTKHIIALYILFIISIIL |
| Ga0181415_10505271 | 3300017732 | Seawater | RCITWWWFRIIRRFIIMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL |
| Ga0181411_10712501 | 3300017755 | Seawater | MKWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181410_11167372 | 3300017763 | Seawater | WFIRRIIIMDKIKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0187220_12148292 | 3300017768 | Seawater | MDKLRKIYYDLETKVKAKPTKHIIALYILFIISIIL |
| Ga0181590_100093246 | 3300017967 | Salt Marsh | MDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181572_105294162 | 3300018049 | Salt Marsh | MDKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0181553_102869733 | 3300018416 | Salt Marsh | MDKLKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181553_102874772 | 3300018416 | Salt Marsh | RTVIMDKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0181553_103010871 | 3300018416 | Salt Marsh | MDKLRKIDYDIETKVKAKPTKHIIALYILVIISII |
| Ga0181563_101930571 | 3300018420 | Salt Marsh | IMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181563_103563022 | 3300018420 | Salt Marsh | TWWWFRIIRRTVIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181592_103061342 | 3300018421 | Salt Marsh | RTVIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181591_104293051 | 3300018424 | Salt Marsh | MDKIRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0181562_103820352 | 3300019459 | Salt Marsh | MDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0181595_104022131 | 3300020053 | Salt Marsh | VIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0206128_13157622 | 3300020166 | Seawater | MDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL |
| Ga0206131_100701462 | 3300020185 | Seawater | MDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSIIS |
| Ga0206131_103660881 | 3300020185 | Seawater | IMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL |
| Ga0211527_100241213 | 3300020378 | Marine | MDKLKKIYYDLETKVKAKPTKHIVALYILVIISIIL |
| Ga0211576_100758163 | 3300020438 | Marine | MDKIKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0213862_102685032 | 3300021347 | Seawater | FRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0222717_101873722 | 3300021957 | Estuarine Water | MNKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0222718_100304754 | 3300021958 | Estuarine Water | MDKLRKIYYDLETKVKAKPTKHIIALYVLVIISIIL |
| Ga0222718_102882322 | 3300021958 | Estuarine Water | MDKLRKIYYDLETKVKAKPTKHIIALYILLIVSIIL |
| Ga0222716_107557931 | 3300021959 | Estuarine Water | RIIRRTIIMNKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0222715_101824342 | 3300021960 | Estuarine Water | TIIMDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0212024_10463571 | 3300022065 | Aqueous | LPIWENIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0196895_10396562 | 3300022067 | Aqueous | TIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0224906_10017774 | 3300022074 | Seawater | MDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL |
| Ga0224906_11759361 | 3300022074 | Seawater | IIRRFIIMDRIKKFYFDLEQKVKAKPTKHIIALYILFIISIIL |
| Ga0212027_10287791 | 3300022168 | Aqueous | RTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0196891_10244482 | 3300022183 | Aqueous | RRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0255773_102093872 | 3300022925 | Salt Marsh | FRIIRRTIIMDKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0255752_100424291 | 3300022929 | Salt Marsh | KYKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0255751_100690971 | 3300023116 | Salt Marsh | WWFRIIRRTVIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0209986_101269262 | 3300024433 | Deep Subsurface | MDKLKKIYYDFETKVKAKPTKHIIALYILVIISIIL |
| Ga0208157_10855912 | 3300025086 | Marine | WSRIIRRFIIMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL |
| Ga0208159_10467273 | 3300025101 | Marine | MDKIKKFYFDLEQKVRAKPTKHIIALYILFIISII |
| Ga0208666_11004042 | 3300025102 | Marine | MDRIKKFYFDLEQKVKAKPTKHIIALYILFIISIIL |
| Ga0209348_10177282 | 3300025127 | Marine | MDKVRKLIYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0208919_10825982 | 3300025128 | Marine | IMDRIKKFYFDLEQKVREKPTKHIIALYILFIISIIL |
| Ga0208149_10486802 | 3300025610 | Aqueous | DKLRKIYYDIETKVKAKPTKHIIALYILVIISIIL |
| Ga0209504_11272391 | 3300025621 | Pelagic Marine | MDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSIIL |
| Ga0208643_11616601 | 3300025645 | Aqueous | IRRIIIMDKLKKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0209196_10776132 | 3300025654 | Pelagic Marine | MDKLNKIYYDIETKIKNKPTKYIIGLYILLIVSIIL |
| Ga0208898_10643662 | 3300025671 | Aqueous | WWWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0208899_11401482 | 3300025759 | Aqueous | DKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0208767_12081931 | 3300025769 | Aqueous | RTIIMDKIRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0208543_11607191 | 3300025810 | Aqueous | LWFRFTRRITIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL |
| Ga0208547_11586261 | 3300025828 | Aqueous | CINWWWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0209603_10201531 | 3300025849 | Pelagic Marine | RRIIIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVSIIL |
| Ga0209534_102266841 | 3300025880 | Pelagic Marine | IIIMDKLNKIYYDIETKIKNKPVKYIIGLYILLIVFIIL |
| Ga0209335_103633892 | 3300025894 | Pelagic Marine | WWCFRIIRRTTLMDKLNKIYYDIETSIKNKPAKYIIGLYILLIVSIIS |
| Ga0209929_11318021 | 3300026187 | Pond Water | RTIIMNKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0185543_10760292 | 3300029318 | Marine | RFIIMDRIKKFYFDLEQKVRAKPTKHIIALYILFIISIIL |
| Ga0307375_104873462 | 3300031669 | Soil | MDKLNKIYYDIETKIKNKPAKYIIGLYVLLIVSIIL |
| Ga0316201_116507692 | 3300032136 | Worm Burrow | MDKLRKIYYDLETKVKAKPTKHIIALYILVIISII |
| Ga0348335_010328_4251_4361 | 3300034374 | Aqueous | MDKLNKIYYDIETKIKNKPTKYIIGLYVLLIVSIIL |
| Ga0348335_126784_627_743 | 3300034374 | Aqueous | IIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| Ga0348337_091077_2_160 | 3300034418 | Aqueous | RCIIRWWFRIIRRTIIMDKLRKIYYDLETKVKAKPTKHIIALYILVIISIIL |
| ⦗Top⦘ |