NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074803

Metagenome / Metatranscriptome Family F074803

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074803
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 47 residues
Representative Sequence MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE
Number of Associated Samples 91
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 4.20 %
% of genes near scaffold ends (potentially truncated) 60.50 %
% of genes from short scaffolds (< 2000 bps) 82.35 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (84.034 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(24.370 % of family members)
Environment Ontology (ENVO) Unclassified
(52.101 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.00%    β-sheet: 0.00%    Coil/Unstructured: 44.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF13884Peptidase_S74 10.92
PF07880T4_gp9_10 2.52
PF00574CLP_protease 1.68
PF12850Metallophos_2 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 3.36
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 3.36
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.28 %
UnclassifiedrootN/A6.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002138|M3t6FKB1_1289853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300003413|JGI25922J50271_10005883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3434Open in IMG/M
3300004240|Ga0007787_10018075All Organisms → cellular organisms → Bacteria → Proteobacteria2928Open in IMG/M
3300004481|Ga0069718_10127233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1157Open in IMG/M
3300004795|Ga0007756_10066011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300005527|Ga0068876_10301952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage909Open in IMG/M
3300005662|Ga0078894_10512068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1076Open in IMG/M
3300006030|Ga0075470_10011480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2730Open in IMG/M
3300006030|Ga0075470_10048027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1309Open in IMG/M
3300006030|Ga0075470_10061625All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300006639|Ga0079301_1036562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1632Open in IMG/M
3300006641|Ga0075471_10062758All Organisms → cellular organisms → Bacteria2044Open in IMG/M
3300006802|Ga0070749_10250779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1002Open in IMG/M
3300006802|Ga0070749_10343856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300006917|Ga0075472_10042840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2137Open in IMG/M
3300006917|Ga0075472_10167750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1078Open in IMG/M
3300006917|Ga0075472_10438743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300007538|Ga0099851_1202848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300007734|Ga0104986_1556Not Available17436Open in IMG/M
3300007973|Ga0105746_1329853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300008113|Ga0114346_1257746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage641Open in IMG/M
3300008266|Ga0114363_1012735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3910Open in IMG/M
3300008266|Ga0114363_1064126Not Available1417Open in IMG/M
3300008266|Ga0114363_1081594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1603Open in IMG/M
3300008266|Ga0114363_1100540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300008266|Ga0114363_1142915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300008266|Ga0114363_1195672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300008266|Ga0114363_1218283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300008448|Ga0114876_1233505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300008448|Ga0114876_1260897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300008450|Ga0114880_1079472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1312Open in IMG/M
3300008450|Ga0114880_1096345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1152Open in IMG/M
3300009059|Ga0102830_1173501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300009081|Ga0105098_10015425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2864Open in IMG/M
3300009111|Ga0115026_11556731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300010354|Ga0129333_11237734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300011268|Ga0151620_1118361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage827Open in IMG/M
3300011337|Ga0153702_1119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30031Open in IMG/M
3300012702|Ga0157596_1143338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3578Open in IMG/M
3300012731|Ga0157616_1068126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1753Open in IMG/M
3300012733|Ga0157606_1408271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1799Open in IMG/M
3300013004|Ga0164293_10188317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1500Open in IMG/M
3300013005|Ga0164292_10564206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage739Open in IMG/M
3300013372|Ga0177922_10215145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage727Open in IMG/M
3300013372|Ga0177922_10748255Not Available1780Open in IMG/M
3300015243|Ga0180041_103736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1459Open in IMG/M
3300017722|Ga0181347_1155533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300017747|Ga0181352_1158293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300017754|Ga0181344_1189631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300017766|Ga0181343_1066496All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300017766|Ga0181343_1098422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300017777|Ga0181357_1046048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1710Open in IMG/M
3300017784|Ga0181348_1258280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300018420|Ga0181563_10278837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage985Open in IMG/M
3300019784|Ga0181359_1094365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1105Open in IMG/M
3300020176|Ga0181556_1093066All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1392Open in IMG/M
3300020494|Ga0208326_108947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300021438|Ga0213920_1002279Not Available9281Open in IMG/M
3300021961|Ga0222714_10213243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1107Open in IMG/M
3300021962|Ga0222713_10360224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage907Open in IMG/M
3300022179|Ga0181353_1006082All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2880Open in IMG/M
3300022190|Ga0181354_1139176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300022190|Ga0181354_1179822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300022407|Ga0181351_1222707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300022752|Ga0214917_10190102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300024554|Ga0255242_1061628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300024556|Ga0256341_1068036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300024560|Ga0256306_1113809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300024560|Ga0256306_1153013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300024568|Ga0255238_1010832Not Available2189Open in IMG/M
3300025585|Ga0208546_1011163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2365Open in IMG/M
3300025585|Ga0208546_1032809All Organisms → Viruses → Predicted Viral1272Open in IMG/M
3300025585|Ga0208546_1054801All Organisms → cellular organisms → Bacteria → Proteobacteria941Open in IMG/M
3300025646|Ga0208161_1110122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300025848|Ga0208005_1009151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3028Open in IMG/M
3300025889|Ga0208644_1182323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage930Open in IMG/M
3300026569|Ga0255277_1110215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300027137|Ga0255092_1049122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300027499|Ga0208788_1041263Not Available1285Open in IMG/M
3300027693|Ga0209704_1164691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300027697|Ga0209033_1035532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. CFD-11880Open in IMG/M
3300027769|Ga0209770_10120804Not Available1069Open in IMG/M
3300027769|Ga0209770_10202245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300027805|Ga0209229_10363323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300027956|Ga0209820_1008119All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2566Open in IMG/M
(restricted) 3300028569|Ga0247843_1090480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1434Open in IMG/M
(restricted) 3300028581|Ga0247840_10301706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300031787|Ga0315900_10202382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1756Open in IMG/M
3300031857|Ga0315909_10073919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3037Open in IMG/M
3300031857|Ga0315909_10262575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1317Open in IMG/M
3300031951|Ga0315904_10692360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300031963|Ga0315901_10545096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300031963|Ga0315901_10663065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300032050|Ga0315906_10677786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300032093|Ga0315902_10148727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2441Open in IMG/M
3300032093|Ga0315902_11164212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300032116|Ga0315903_10705880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300032116|Ga0315903_10760147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300033416|Ga0316622_100839075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300033980|Ga0334981_0158056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300033981|Ga0334982_0093704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1591Open in IMG/M
3300033981|Ga0334982_0113667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1413Open in IMG/M
3300033981|Ga0334982_0173301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1083Open in IMG/M
3300033993|Ga0334994_0177033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
3300033996|Ga0334979_0260637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300034012|Ga0334986_0373144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300034018|Ga0334985_0168550All Organisms → Viruses → Predicted Viral1477Open in IMG/M
3300034020|Ga0335002_0110405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1850Open in IMG/M
3300034061|Ga0334987_0148235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1721Open in IMG/M
3300034061|Ga0334987_0502826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300034066|Ga0335019_0003159Not Available10991Open in IMG/M
3300034101|Ga0335027_0115351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2024Open in IMG/M
3300034104|Ga0335031_0279343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1095Open in IMG/M
3300034112|Ga0335066_0245953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1036Open in IMG/M
3300034117|Ga0335033_0093731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1745Open in IMG/M
3300034283|Ga0335007_0056471All Organisms → Viruses → Predicted Viral3010Open in IMG/M
3300034283|Ga0335007_0151273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1661Open in IMG/M
3300034284|Ga0335013_0547701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300034356|Ga0335048_0139444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1403Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater24.37%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.81%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.24%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.72%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.52%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.68%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.68%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.68%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.84%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.84%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.84%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.84%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.84%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.84%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002138M3t6FKB1 (102f)EnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011337Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - IlsanEnvironmentalOpen in IMG/M
3300012702Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300015243Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020494Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024554Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024556Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027137Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
M3t6FKB1_128985333300002138MarineMIKIELTIEQVQNLHQLLVIGMKAGDVNNMRVGLPLVDAIEAAAKASQSKPE*
JGI25922J50271_1000588373300003413Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0007787_1001807563300004240Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE*
Ga0069718_1012723323300004481SedimentMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT*
Ga0007756_1006601113300004795Freshwater LakeQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0068876_1030195243300005527Freshwater LakeMIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE*
Ga0078894_1051206813300005662Freshwater LakeDMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0075470_1001148073300006030AqueousMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE*
Ga0075470_1004802733300006030AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE*
Ga0075470_1006162533300006030AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLV
Ga0079301_103656253300006639Deep SubsurfaceMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPIVEILETAAAQHKPE*
Ga0075471_1006275853300006641AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE*
Ga0070749_1025077913300006802AqueousQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE*
Ga0070749_1034385643300006802AqueousMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE*
Ga0075472_1004284063300006917AqueousMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILE
Ga0075472_1016775013300006917AqueousNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE*
Ga0075472_1043874323300006917AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQA
Ga0099851_120284843300007538AqueousPQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAAQHKPE*
Ga0104986_1556123300007734FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVETLEAAAKASQPTD*
Ga0105746_132985313300007973Estuary WaterDRMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILETAAAQHKPE*
Ga0114346_125774613300008113Freshwater, PlanktonPPDMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0114363_1012735103300008266Freshwater, PlanktonMEITIKLTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILETAAAQHKPE*
Ga0114363_106412663300008266Freshwater, PlanktonRMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE*
Ga0114363_108159413300008266Freshwater, PlanktonMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPL
Ga0114363_110054033300008266Freshwater, PlanktonMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLV
Ga0114363_114291533300008266Freshwater, PlanktonMIKIELTPQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAQHKPE*
Ga0114363_119567223300008266Freshwater, PlanktonMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQLPLVEILETAAAQHKPE*
Ga0114363_121828313300008266Freshwater, PlanktonMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLP
Ga0114876_123350523300008448Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE*
Ga0114876_126089713300008448Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLV
Ga0114880_107947213300008450Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLP
Ga0114880_109634553300008450Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE*
Ga0102830_117350113300009059EstuarineQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0105098_1001542533300009081Freshwater SedimentMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE*
Ga0115026_1155673123300009111WetlandMIKIELTPQQLNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE*
Ga0129333_1123773423300010354Freshwater To Marine Saline GradientMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE*
Ga0151620_111836143300011268FreshwaterVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE*
Ga0153702_1119403300011337FreshwaterMIKIEFTPQQFNQLYELLVIGMKAGNVTNMKVGIPLVDLLEAAAAQHKPE*
Ga0157596_114333873300012702FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQLNFT*
Ga0157616_106812643300012731FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNP
Ga0157606_140827113300012733FreshwaterRCRSSCRMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT*
Ga0164293_1018831733300013004FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAK
Ga0164292_1056420633300013005FreshwaterELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT*
Ga0177922_1021514543300013372FreshwaterDSDRMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE*
Ga0177922_1074825563300013372FreshwaterMIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLETAAAQHKPE*
Ga0180041_10373613300015243FreshwaterMIKIELTQEQANQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT*
Ga0181347_115553323300017722Freshwater LakeMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNLT
Ga0181352_115829313300017747Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVE
Ga0181344_118963113300017754Freshwater LakeIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE
Ga0181343_106649613300017766Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKP
Ga0181343_109842243300017766Freshwater LakeGCGAGHRCRSSCRMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT
Ga0181357_104604843300017777Freshwater LakeMIQIELTPQQFNQLYDLLVIGMKAGNVNNMKVGLPLVEILETAAAQHKP
Ga0181348_125828033300017784Freshwater LakeMIQIELTPQQFNQLYDLLVIGMKAGNVNNMKVGLPLV
Ga0181563_1027883753300018420Salt MarshDRSSRRMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE
Ga0181359_109436523300019784Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE
Ga0181556_109306623300020176Salt MarshMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE
Ga0208326_10894723300020494FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAQHKPE
Ga0213920_100227913300021438FreshwaterMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE
Ga0222714_1021324323300021961Estuarine WaterMIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLETAAAQHKPE
Ga0222713_1036022413300021962Estuarine WaterMIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLET
Ga0181353_100608213300022179Freshwater LakeMIQIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE
Ga0181354_113917613300022190Freshwater LakeRCSYRCMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE
Ga0181354_117982213300022190Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPL
Ga0181351_122270743300022407Freshwater LakeRRMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE
Ga0214917_1019010213300022752FreshwaterMIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE
Ga0255242_106162833300024554FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILEAAAATSQAKPE
Ga0256341_106803613300024556FreshwaterKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE
Ga0256306_111380913300024560FreshwaterMIKIELTPQQFNQFYELLVIGMKAGNVQNMKVGLP
Ga0256306_115301313300024560FreshwaterMIQIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0255238_101083263300024568FreshwaterMINIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0208546_101116313300025585AqueousMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKP
Ga0208546_103280923300025585AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE
Ga0208546_105480133300025585AqueousMIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHK
Ga0208161_111012223300025646AqueousMIKIELTPQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAQHKPE
Ga0208005_100915113300025848AqueousMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHK
Ga0208644_118232323300025889AqueousMEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE
Ga0255277_111021523300026569FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE
Ga0255092_104912243300027137FreshwaterPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0208788_104126353300027499Deep SubsurfaceMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPIVEILETAAAQHKPE
Ga0209704_116469113300027693Freshwater SedimentRCRSSCRMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE
Ga0209033_103553273300027697Freshwater LakeSCSGDRSSRRMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE
Ga0209770_1012080443300027769Freshwater LakeELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0209770_1020224543300027769Freshwater LakeMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAAQHKPE
Ga0209229_1036332313300027805Freshwater And SedimentMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVD
Ga0209820_100811913300027956Freshwater SedimentMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLV
(restricted) Ga0247843_109048023300028569FreshwaterMIQIELTPQQFNQLYELLVIGMKAGNVNNMKIGIPLVEILETAAAQHKPE
(restricted) Ga0247840_1030170613300028581FreshwaterELTPQQFNQLYELLVIGMKAGNVNNMKIGIPLVEILETAAAQHKPE
Ga0315900_1020238213300031787FreshwaterFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0315909_1007391913300031857FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILET
Ga0315909_1026257533300031857FreshwaterMIKIELTPQQLNQLYELLVIGMKAGNVQNMKVGIPLVEILETAAAQHKPE
Ga0315904_1069236013300031951FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELL
Ga0315901_1054509613300031963FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEIL
Ga0315901_1066306533300031963FreshwaterTNDQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0315906_1067778623300032050FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILE
Ga0315902_1014872713300032093FreshwaterLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0315902_1116421213300032093FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAA
Ga0315903_1070588033300032116FreshwaterQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0315903_1076014713300032116FreshwaterYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0316622_10083907553300033416SoilRMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT
Ga0334981_0158056_627_7853300033980FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAYSQSKPE
Ga0334982_0093704_3_1493300033981FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSN
Ga0334982_0113667_1269_14123300033981FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQ
Ga0334982_0173301_2_1333300033981FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAA
Ga0334994_0177033_2_1153300033993FreshwaterMIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLPLYE
Ga0334979_0260637_2_1393300033996FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKN
Ga0334986_0373144_2_1213300034012FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDIL
Ga0334985_0168550_1330_14763300034018FreshwaterELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE
Ga0335002_0110405_1720_18483300034020FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEA
Ga0334987_0148235_315_4673300034061FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILEAAAAQHKPE
Ga0334987_0502826_50_2023300034061FreshwaterMIEIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0335019_0003159_7164_73163300034066FreshwaterMIKIELTPQQFNQLYELLIIGMKAGNVQNMKVGLPLVEILETAAAQHKPE
Ga0335027_0115351_1908_20243300034101FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVEL
Ga0335031_0279343_974_10933300034104FreshwaterMIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLPLYESI
Ga0335066_0245953_2_1063300034112FreshwaterMIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLP
Ga0335033_0093731_1_1263300034117FreshwaterMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILES
Ga0335007_0056471_2858_30103300034283FreshwaterKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE
Ga0335007_0151273_933_10883300034283FreshwaterMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNPSNPT
Ga0335013_0547701_541_6843300034284FreshwaterELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT
Ga0335048_0139444_1256_14023300034356FreshwaterKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.