NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074678

Metagenome / Metatranscriptome Family F074678

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074678
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 43 residues
Representative Sequence DVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Number of Associated Samples 109
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.20 %
% of genes near scaffold ends (potentially truncated) 89.92 %
% of genes from short scaffolds (< 2000 bps) 85.71 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.639 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(21.849 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.261 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.49%    β-sheet: 15.94%    Coil/Unstructured: 69.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF12867DinB_2 24.37
PF05685Uma2 7.56
PF04909Amidohydro_2 6.72
PF00296Bac_luciferase 5.88
PF12838Fer4_7 5.04
PF08241Methyltransf_11 4.20
PF05013FGase 3.36
PF01850PIN 2.52
PF08281Sigma70_r4_2 1.68
PF00903Glyoxalase 1.68
PF00578AhpC-TSA 1.68
PF00535Glycos_transf_2 1.68
PF03328HpcH_HpaI 1.68
PF02604PhdYeFM_antitox 0.84
PF00501AMP-binding 0.84
PF12862ANAPC5 0.84
PF00583Acetyltransf_1 0.84
PF02775TPP_enzyme_C 0.84
PF01042Ribonuc_L-PSP 0.84
PF027395_3_exonuc_N 0.84
PF13701DDE_Tnp_1_4 0.84
PF00561Abhydrolase_1 0.84
PF02668TauD 0.84
PF00528BPD_transp_1 0.84
PF00672HAMP 0.84
PF02225PA 0.84
PF12681Glyoxalase_2 0.84
PF00529CusB_dom_1 0.84
PF13649Methyltransf_25 0.84
PF04073tRNA_edit 0.84
PF16694Cytochrome_P460 0.84
PF01244Peptidase_M19 0.84
PF12275DUF3616 0.84
PF01855POR_N 0.84
PF13193AMP-binding_C 0.84
PF13490zf-HC2 0.84
PF030614HBT 0.84
PF07885Ion_trans_2 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 7.56
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 5.88
COG3741N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 3.36
COG3931Predicted N-formylglutamate amidohydrolaseAmino acid transport and metabolism [E] 3.36
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 1.68
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 1.68
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 1.68
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.84
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.84
COG0674Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.84
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.84
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.84
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.84
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.84
COG4231TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.64 %
UnclassifiedrootN/A3.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101526454Not Available707Open in IMG/M
3300000956|JGI10216J12902_111246625All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300002243|C687J29039_10271448All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300002560|JGI25383J37093_10109495All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300002561|JGI25384J37096_10134894All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300002562|JGI25382J37095_10141311All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300003996|Ga0055467_10302372All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M
3300004463|Ga0063356_100017239All Organisms → cellular organisms → Bacteria → Proteobacteria6674Open in IMG/M
3300004633|Ga0066395_10077254All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300005174|Ga0066680_10287533All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005180|Ga0066685_10493353All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005181|Ga0066678_10907533All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005184|Ga0066671_10014166All Organisms → cellular organisms → Bacteria3326Open in IMG/M
3300005332|Ga0066388_106585944All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005444|Ga0070694_101049996All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005539|Ga0068853_101103718All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005552|Ga0066701_10376609All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005553|Ga0066695_10400927All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300005569|Ga0066705_10530782All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005569|Ga0066705_10579951All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005574|Ga0066694_10392761All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005598|Ga0066706_10120143All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300005617|Ga0068859_102927203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300005713|Ga0066905_100277919All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300005713|Ga0066905_101626685All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300005713|Ga0066905_102064383All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005764|Ga0066903_100321301All Organisms → cellular organisms → Bacteria → Proteobacteria2472Open in IMG/M
3300006031|Ga0066651_10018055All Organisms → cellular organisms → Bacteria → Proteobacteria2995Open in IMG/M
3300006794|Ga0066658_10105656All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300006796|Ga0066665_10040622All Organisms → cellular organisms → Bacteria → Proteobacteria3136Open in IMG/M
3300006797|Ga0066659_10969729All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300006852|Ga0075433_10001127All Organisms → cellular organisms → Bacteria19352Open in IMG/M
3300006854|Ga0075425_101579134All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300006854|Ga0075425_103080169All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006903|Ga0075426_10284588All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300006904|Ga0075424_100726889All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300006904|Ga0075424_101341351All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006904|Ga0075424_101999532All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006914|Ga0075436_100805379All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006914|Ga0075436_101163996All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300007004|Ga0079218_10989281All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium841Open in IMG/M
3300009012|Ga0066710_100024271All Organisms → cellular organisms → Bacteria6847Open in IMG/M
3300009088|Ga0099830_10156874All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300009088|Ga0099830_10210754All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300009089|Ga0099828_10166642All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300009137|Ga0066709_100045911All Organisms → cellular organisms → Bacteria4866Open in IMG/M
3300009137|Ga0066709_100104254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia3487Open in IMG/M
3300009157|Ga0105092_10584403All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria644Open in IMG/M
3300009162|Ga0075423_11004104All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria886Open in IMG/M
3300009176|Ga0105242_13239468All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia506Open in IMG/M
3300009553|Ga0105249_11021778All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria896Open in IMG/M
3300010043|Ga0126380_12148470All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria515Open in IMG/M
3300010046|Ga0126384_10105894All Organisms → cellular organisms → Bacteria2085Open in IMG/M
3300010303|Ga0134082_10100153All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300010304|Ga0134088_10484380All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria608Open in IMG/M
3300010320|Ga0134109_10387388All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300010322|Ga0134084_10094185All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium948Open in IMG/M
3300010325|Ga0134064_10107560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria925Open in IMG/M
3300010333|Ga0134080_10205371All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium855Open in IMG/M
3300010333|Ga0134080_10593870Not Available538Open in IMG/M
3300010359|Ga0126376_11011282All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300010360|Ga0126372_11239258All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria772Open in IMG/M
3300010362|Ga0126377_11800187All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria688Open in IMG/M
3300010375|Ga0105239_11700735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria730Open in IMG/M
3300010397|Ga0134124_10502626All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1173Open in IMG/M
3300012096|Ga0137389_10215997All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1602Open in IMG/M
3300012189|Ga0137388_11569005All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300012198|Ga0137364_10015435All Organisms → cellular organisms → Bacteria4536Open in IMG/M
3300012199|Ga0137383_10451733All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium941Open in IMG/M
3300012206|Ga0137380_10149238All Organisms → cellular organisms → Bacteria2132Open in IMG/M
3300012410|Ga0134060_1047358Not Available647Open in IMG/M
3300012929|Ga0137404_10610258All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300013100|Ga0157373_11013838All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria620Open in IMG/M
3300014150|Ga0134081_10018356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1949Open in IMG/M
3300015264|Ga0137403_10305055All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300015372|Ga0132256_101508030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria783Open in IMG/M
3300015373|Ga0132257_102352408All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria691Open in IMG/M
3300017654|Ga0134069_1070443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1117Open in IMG/M
3300017659|Ga0134083_10030875All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300017792|Ga0163161_10983098All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium720Open in IMG/M
3300018063|Ga0184637_10724436All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria540Open in IMG/M
3300018433|Ga0066667_11228980All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300019377|Ga0190264_12335836All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300020018|Ga0193721_1166818All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300021080|Ga0210382_10383349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium622Open in IMG/M
3300021344|Ga0193719_10374599All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium589Open in IMG/M
3300022694|Ga0222623_10421021All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium507Open in IMG/M
3300025900|Ga0207710_10410508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia696Open in IMG/M
3300025921|Ga0207652_10331799All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300025934|Ga0207686_11456772All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300025961|Ga0207712_10735472All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria863Open in IMG/M
3300026089|Ga0207648_12054927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300026312|Ga0209153_1094452All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1117Open in IMG/M
3300026329|Ga0209375_1046291All Organisms → cellular organisms → Bacteria2203Open in IMG/M
3300026330|Ga0209473_1040067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2083Open in IMG/M
3300026334|Ga0209377_1051737All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300026528|Ga0209378_1004864All Organisms → cellular organisms → Bacteria8845Open in IMG/M
3300026538|Ga0209056_10469652All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria687Open in IMG/M
3300026540|Ga0209376_1088105All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300026547|Ga0209156_10175674All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300026548|Ga0209161_10412962Not Available593Open in IMG/M
3300027646|Ga0209466_1022270All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300027748|Ga0209689_1332021All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium583Open in IMG/M
3300027862|Ga0209701_10387723All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300028809|Ga0247824_10642550All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria641Open in IMG/M
3300028878|Ga0307278_10245964All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300030619|Ga0268386_10148874All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300031545|Ga0318541_10669557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300031546|Ga0318538_10045408All Organisms → cellular organisms → Bacteria2125Open in IMG/M
3300031561|Ga0318528_10249806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium951Open in IMG/M
3300031564|Ga0318573_10017765All Organisms → cellular organisms → Bacteria3152Open in IMG/M
3300031781|Ga0318547_10099790All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300031846|Ga0318512_10087386All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300031908|Ga0310900_10675599All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria824Open in IMG/M
3300032010|Ga0318569_10583624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300032179|Ga0310889_10311532All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria762Open in IMG/M
3300032180|Ga0307471_100747060All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300032205|Ga0307472_101787114All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria610Open in IMG/M
3300034147|Ga0364925_0076184All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1167Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil21.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.84%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.84%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10152645433300000364SoilPPRVVDQTIVVDRDGFVRWFSVSRNFQVRPDPGDVLRVVRSL*
JGI10216J12902_11124662523300000956SoilPIPTTVVLDRNGVVRWLWISNNFQVRPDPNAVLAAVRAL*
C687J29039_1027144813300002243SoilATVVLDRDGVVRWFSVSRNYQVRPDPDDVLRAVRAL*
JGI25383J37093_1010949513300002560Grasslands SoilPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPAPDDVLRAVRAL*
JGI25384J37096_1013489413300002561Grasslands SoilGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
JGI25382J37095_1014131113300002562Grasslands SoilDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0055467_1030237223300003996Natural And Restored WetlandsYGQDVPRPSTVVLDRDGLVRWVSVTRNYQVRPDPDEVLRALRALPPAR*
Ga0063356_10001723963300004463Arabidopsis Thaliana RhizosphereVHVAGGQSGEDVPLPATVIVDRDGRVRWVSVTDNFQVRPDPGLVARVLREL*
Ga0066395_1007725433300004633Tropical Forest SoilEGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPGDVLRAVRAL*
Ga0066680_1028753333300005174SoilGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVRRAVRAL*
Ga0066685_1049335323300005180SoilGQHGEDVPTPTTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL*
Ga0066678_1090753313300005181SoilLVHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL*
Ga0066671_1001416613300005184SoilDVPQPATVVLDRDGVVRWFSVSHNFQVRPDPGDVIRIVRSL*
Ga0066388_10658594423300005332Tropical Forest SoilMQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAGRAL*
Ga0070694_10104999623300005444Corn, Switchgrass And Miscanthus RhizosphereARNVLAGGAAGQDVPRPATIVVDRDGVVRWAQLADNVQVRPDAREVLRAVRSL*
Ga0068853_10110371813300005539Corn RhizosphereEDVPKPATIVIDRDGVVRWYKVSHNFQVRPDPGDVLKAVRAL*
Ga0066701_1037660913300005552SoilEDVPRPATVVLDRDGVVRWLSLSNNFQVRPDPGDVLRAVRAL*
Ga0066695_1040092733300005553SoilGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL*
Ga0066705_1053078223300005569SoilGLVHAHGGPNGEDVPQPATVVLDRDGVVRWFSVSHNFQVRPDPGDVIRIVRSL*
Ga0066705_1057995113300005569SoilVVLDRDGVVRWLWVSDNFQVRPDPNDVLRAVRAL*
Ga0066694_1039276123300005574SoilVPRPATIVIDRNGIVRWVKVAANVQTRPDSREVLRAVRAL*
Ga0066706_1012014333300005598SoilVTRRVGLVHPGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL*
Ga0068859_10292720313300005617Switchgrass RhizosphereTVVIDRDGIVRWFSVSRNFQVRPDPGDVLRAVRAL*
Ga0066905_10027791933300005713Tropical Forest SoilGPDGQDVPRPATVVLDRDGVVRWYSVSHNFQVRPDPGDVLRAVRAL*
Ga0066905_10162668523300005713Tropical Forest SoilGGPDGRDVPRPATVVVDRDGVVRWFSVTRNVQVRPDPGDVLHVLRGL*
Ga0066905_10206438313300005713Tropical Forest SoilGGAHGEDVPTPTTVVLDRDGVVRWLWISGNFQLRPDPDEVLRAVRAL*
Ga0066903_10032130113300005764Tropical Forest SoilMQDVPRPATVVLDRDGVVRWFSTSKNAQVRFDPNDVLRAARAL*
Ga0066651_1001805563300006031SoilGGGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0066658_1010565623300006794SoilVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0066665_1004062213300006796SoilPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0066659_1096972913300006797SoilTVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0075433_10001127223300006852Populus RhizosphereASGEDVPIPTTVVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL*
Ga0075425_10157913423300006854Populus RhizosphereTLVLDRDGVVRWVSVSRNFQVRPDPGDVLRAVRAL*
Ga0075425_10308016913300006854Populus RhizosphereVVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL*
Ga0075426_1028458833300006903Populus RhizosphereQGGQDVPRPATVVIDRQGVVRWTAYADNFQLRPDPREVRRAIRAL*
Ga0075424_10072688913300006904Populus RhizosphereGGKDVPRPATVVIDRQGIVRWAAYADNVQSRPDTQDVLRAVRAL*
Ga0075424_10134135113300006904Populus RhizosphereHPRGGPDGQDVPRPATVLLDRNGVVRWLSLSSNYQVRPDPRDVVRAVRAL*
Ga0075424_10199953223300006904Populus RhizosphereQDVPRPATIVVDRDGFVRWFSVSRNFQVRPDPGDVLRVVRSL*
Ga0075436_10080537913300006914Populus RhizosphereARGGADGQDVPRPATVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL*
Ga0075436_10116399613300006914Populus RhizosphereGEDVPIPTTVVLDRDGVVRWLWISNNFQVRPDPEAVLAAVRGL*
Ga0079218_1098928123300007004Agricultural SoilVPATVVVDRAGVVRWAAYAENFQVRPDPRDVLQALKSL*
Ga0066710_10002427113300009012Grasslands SoilGQDVPRPTTVVLDRDGVVRWFSITRNFQVRPDPGDVLRAVRAL
Ga0099830_1015687453300009088Vadose Zone SoilVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0099830_1021075413300009088Vadose Zone SoilVPRPATVVLDRDGVVRWFSVSRNFQVRPDPEDVLRAVRAL*
Ga0099828_1016664243300009089Vadose Zone SoilVVLDRDGVVRWFSVSRNFQVHPDPDDVLRAVRAL*
Ga0066709_10004591113300009137Grasslands SoilGEDVPRPATLVLDRDGVVRWLSVSRNFQVRPDPGDVLRAVRAL*
Ga0066709_10010425433300009137Grasslands SoilVHQGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL*
Ga0105092_1058440323300009157Freshwater SedimentDVPRPATVVLDRDGVVRWVSLSDNYQVRPDPREVVRAVRAISG*
Ga0075423_1100410413300009162Populus RhizospherePRGGPNGEDVPRPATLVLDRDGLVRWVSVSRNFQVRPDPGDVLRAVRAL*
Ga0105242_1323946813300009176Miscanthus RhizosphereATIVLDRDGVVRWFSVSRNFQVRQDPGDVLRAVRAL*
Ga0105249_1102177813300009553Switchgrass RhizosphereTIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS*
Ga0126380_1214847023300010043Tropical Forest SoilDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0126384_1010589413300010046Tropical Forest SoilTVVLDKDGVVRWFSVSHNFQVRPDPEDVLRAVRAL*
Ga0134082_1010015323300010303Grasslands SoilTVVLDRDGVVRWFSVTRNFQVRPDPNDVLCAVRAL*
Ga0134088_1048438023300010304Grasslands SoilVHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL*
Ga0134109_1038738813300010320Grasslands SoilPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0134084_1009418513300010322Grasslands SoilTVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL*
Ga0134064_1010756013300010325Grasslands SoilVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL*
Ga0134080_1020537133300010333Grasslands SoilGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0134080_1059387013300010333Grasslands SoilTTVVLDRAGVVRWLWVSDNFQVRPDPNEVLRAVRAL*
Ga0126376_1101128213300010359Tropical Forest SoilMQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAVRAL*
Ga0126372_1123925813300010360Tropical Forest SoilRARGHMQDVPRPATVVLDRDGVVRWFSISKNAQVRFDPNDVLRAGRAL*
Ga0126377_1180018723300010362Tropical Forest SoilATIVLDRDGVVRWFSVSSNFQVRPDPDAVLRAVRGQS*
Ga0105239_1170073523300010375Corn RhizosphereVHARGGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS*
Ga0134124_1050262633300010397Terrestrial SoilVVLDRDGVVRWMSLSDNFQVRPAAGDVLRAVRTL*
Ga0137389_1021599723300012096Vadose Zone SoilLVHAGAGPDGQEVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0137388_1156900523300012189Vadose Zone SoilGQDVPRPATIVIDRNGVVRWARVADNIQTRPDAREVLRVVRAL*
Ga0137364_1001543513300012198Vadose Zone SoilGPEGQDVPRPATVVVDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0137383_1045173313300012199Vadose Zone SoilRPATVVLDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL*
Ga0137380_1014923813300012206Vadose Zone SoilHAGGGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL*
Ga0134060_104735823300012410Grasslands SoilTVVLDRDGVVRWLWISDNFQVRPDPDAVLGAVRAL*
Ga0137404_1061025813300012929Vadose Zone SoilHPGGGPDGQDVPRPATVVLDRDGVVRWFSASHNFQVRPDPGDVLRAVRAL*
Ga0157373_1101383823300013100Corn RhizospherePRPATIVVDRDGVVRWFSVTDNFQVRPDPGDVLRAIRGLS*
Ga0134081_1001835613300014150Grasslands SoilGPDGHDVPRPATVVLDRDGVVRWFSISRNFQVRPDPDDVLRAVRAL*
Ga0137403_1030505533300015264Vadose Zone SoilHPGGGPDGQDVPRPATVVLDRDGVVRWFSVSHNFQVRPDPGDVLRAVRAL*
Ga0132256_10150803023300015372Arabidopsis RhizosphereEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS*
Ga0132257_10235240823300015373Arabidopsis RhizosphereGGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS*
Ga0134069_107044323300017654Grasslands SoilVHARGGQHGEDVPTPTTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL
Ga0134083_1003087553300017659Grasslands SoilLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRALYQAG
Ga0163161_1098309823300017792Switchgrass RhizosphereVHARGGPSGEDVPRPATIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS
Ga0184637_1072443613300018063Groundwater SedimentATIVLDRDGVVRWFSVSSNFQVRPDPGEVLRAVRAL
Ga0066667_1122898013300018433Grasslands SoilGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0190264_1233583613300019377SoilKDVPRPATVVVDKQGVVRWFSASHNFQVRPAPGEVLRVVRSLVAEKG
Ga0193721_116681813300020018SoilDGQDVPRPATVVLDREGIVRWFSVSHNFQVRPDPGDVLRAIRAL
Ga0210382_1038334913300021080Groundwater SedimentRGGPDRQDVPRPATVVLDRAGVVRWFSASHNFQVRPAPGDVLRVVRSLVPEKG
Ga0193719_1037459913300021344SoilGGPDGQDVPRPATVVLDRAGVVRWFSVSHNFQVRPAPGDVLRVVRSLVAEKG
Ga0222623_1042102113300022694Groundwater SedimentARGGRDGEDVPRPATVVLDRDGVVRWFSVSHNFQVRPDPGDVLRRVRSLVAERG
Ga0207710_1041050823300025900Switchgrass RhizospherePATIVLDRDGVVRWFSVSRNFQVRPDPGDVLRAVRAL
Ga0207652_1033179933300025921Corn RhizosphereDVPRPATIVLDRDGVVRWFSVTDNFQVRPDPGDVLRAVRAL
Ga0207686_1145677213300025934Miscanthus RhizosphereDRDGIVRWFSVARNFQVRPAPGDVLRVVRSLRGEKG
Ga0207712_1073547223300025961Switchgrass RhizosphereTIVLDRNGVVRWLSISSNFQVRPDPADVLRAVRGLS
Ga0207648_1205492723300026089Miscanthus RhizosphereGENGQDVPVPATVVIDRNGVVRWAAYAENFQVRPDPRDVVRAVKSL
Ga0209153_109445223300026312SoilTTVVLDRDGVVRWLWVSNNFQVRPDPEAVLHAVRAL
Ga0209375_104629113300026329SoilGGPDGQDVPRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0209473_104006743300026330SoilGGGPEGQDVPRPATVVVDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0209377_105173723300026334SoilATVVVDRDGVVRWFSVTRNFQVGPDPDDVLRAVRAL
Ga0209378_100486493300026528SoilATVVLDRDGVVRWFSVSRNFQVRPDPDDVRRAVRAL
Ga0209056_1046965223300026538SoilVHPGGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL
Ga0209376_108810553300026540SoilRPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0209156_1017567433300026547SoilGQDVPRPATVVLDRDGVVRWFSITRNFQARPDPDDVLRAVRAL
Ga0209161_1041296233300026548SoilAVTRRVGLVHPGGEGGQDVPRPATIVIDRNGVVRWARVADNIQTRPDSREVLRAVRAL
Ga0209466_102227023300027646Tropical Forest SoilPATVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0209689_133202113300027748SoilTVVVDRDGVVRWFSVTRNFQVRPDPDDVLRAVRAL
Ga0209701_1038772323300027862Vadose Zone SoilGQDVPRPTTVVLDRDGVVRWFSVSRNFQVRPDPDDVLRAVRAL
Ga0247824_1064255013300028809SoilTVAGRGGSEGQDVPRPATVVLDRNGVVRWFSVTANFQVRPDAADVLRAVRAL
Ga0307278_1024596413300028878SoilEGQDVPRPATIVLDRDGVVRWFSVSSNFQVRPDPGEVLRAVRSL
Ga0268386_1014887413300030619SoilRPATVVLDRDGVVRWFSVSRNFQIRPDPDDVRRAVRAL
Ga0318541_1066955723300031545SoilRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0318538_1004540843300031546SoilRGGPDGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0318528_1024980623300031561SoilIHARGGPDGQDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0318573_1001776553300031564SoilDVPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0318547_1009979013300031781SoilDVPRPATVILDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0318512_1008738633300031846SoilPRPATVVLDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0310900_1067559913300031908SoilPRPATIVLDRDGVVRWFSVTDNFQVRPDPGDVLRAVRAL
Ga0318569_1058362413300032010SoilATVILDKDGVVRWFSVSHNFQVRPDPNDVLRAVRAL
Ga0310889_1031153213300032179SoilTVVVDRDGVVRWVSVSNNFQVRPDPAEVLRAVRAL
Ga0307471_10074706013300032180Hardwood Forest SoilPATIVLDRDGVVKWFSVSRNFQVRPDPDDVLRAVRAL
Ga0307472_10178711413300032205Hardwood Forest SoilRPATLVLDRDGVVRWLSLSDNFQVRPDPGDVLRAVRAL
Ga0364925_0076184_2_1513300034147SedimentDGQDVPRPATVVLDRDGVVRWFSASHNFQVRPDPGDVLRVVRSLMAEKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.