Basic Information | |
---|---|
Family ID | F074599 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 44 residues |
Representative Sequence | DELNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPKIPSKR |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.84 % |
% of genes near scaffold ends (potentially truncated) | 98.32 % |
% of genes from short scaffolds (< 2000 bps) | 94.96 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.798 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.101 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 0.00% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00756 | Esterase | 31.09 |
PF12796 | Ank_2 | 9.24 |
PF13442 | Cytochrome_CBB3 | 9.24 |
PF08450 | SGL | 2.52 |
PF13857 | Ank_5 | 1.68 |
PF07350 | DUF1479 | 1.68 |
PF04227 | Indigoidine_A | 0.84 |
PF13091 | PLDc_2 | 0.84 |
PF13637 | Ank_4 | 0.84 |
PF06736 | TMEM175 | 0.84 |
PF01263 | Aldose_epim | 0.84 |
PF02738 | MoCoBD_1 | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.52 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.52 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.84 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.84 |
COG2313 | Pseudouridine-5'-phosphate glycosidase (pseudoU degradation) | Nucleotide transport and metabolism [F] | 0.84 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.80 % |
Unclassified | root | N/A | 4.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725004|GPKC_F5V46DG04H802V | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
2170459003|FZN2CUW02GOEI5 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 517 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_13727332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 588 | Open in IMG/M |
3300000881|JGI10215J12807_1161175 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300004479|Ga0062595_101662679 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300004643|Ga0062591_100192539 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
3300005340|Ga0070689_100484038 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300005343|Ga0070687_101388347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300005353|Ga0070669_100953017 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005445|Ga0070708_100998433 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300005467|Ga0070706_101232147 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005526|Ga0073909_10400582 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300005536|Ga0070697_100913955 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005566|Ga0066693_10401425 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005617|Ga0068859_102486277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300005713|Ga0066905_100180521 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300005713|Ga0066905_101372388 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005713|Ga0066905_102050433 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300005719|Ga0068861_102018029 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300006031|Ga0066651_10297712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300006051|Ga0075364_10661224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300006800|Ga0066660_10097987 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
3300006844|Ga0075428_100536939 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300006845|Ga0075421_100571216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1333 | Open in IMG/M |
3300006845|Ga0075421_102031133 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006871|Ga0075434_102038069 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300006871|Ga0075434_102198437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300006871|Ga0075434_102396409 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006871|Ga0075434_102655044 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300006876|Ga0079217_10781793 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300006881|Ga0068865_100876611 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300006894|Ga0079215_10541705 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300006904|Ga0075424_102702913 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006914|Ga0075436_101284434 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300006914|Ga0075436_101544242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300007004|Ga0079218_10212606 | Not Available | 1488 | Open in IMG/M |
3300007004|Ga0079218_10724945 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300007004|Ga0079218_11675262 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300007004|Ga0079218_13775130 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009090|Ga0099827_10841979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300009101|Ga0105247_10665068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 780 | Open in IMG/M |
3300009101|Ga0105247_11585166 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009101|Ga0105247_11881336 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009137|Ga0066709_103723292 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009147|Ga0114129_12366754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300009147|Ga0114129_12516600 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009148|Ga0105243_10729308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300009148|Ga0105243_12069001 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300009156|Ga0111538_13791770 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300009166|Ga0105100_10310805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300009177|Ga0105248_10635517 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300009553|Ga0105249_11318937 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010333|Ga0134080_10659442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300010364|Ga0134066_10028761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
3300010375|Ga0105239_10726758 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300010397|Ga0134124_11527998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300010400|Ga0134122_12273401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300010401|Ga0134121_13118398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300012212|Ga0150985_106612422 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012358|Ga0137368_10504657 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300012363|Ga0137390_11849613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300012532|Ga0137373_11317962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012896|Ga0157303_10131043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300012925|Ga0137419_11603222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300012927|Ga0137416_10907266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300012944|Ga0137410_11162414 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300012944|Ga0137410_11283670 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012957|Ga0164303_10668196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Denitrobaculum → Denitrobaculum tricleocarpae | 695 | Open in IMG/M |
3300012960|Ga0164301_10884103 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300012971|Ga0126369_10970451 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300012977|Ga0134087_10001559 | All Organisms → cellular organisms → Bacteria | 6567 | Open in IMG/M |
3300012986|Ga0164304_11443585 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012989|Ga0164305_11677545 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300013296|Ga0157374_11539483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300013308|Ga0157375_11490542 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300013308|Ga0157375_13485206 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300016270|Ga0182036_11188215 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300016319|Ga0182033_10039519 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
3300016341|Ga0182035_11440266 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300016445|Ga0182038_10849042 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300018027|Ga0184605_10455027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300018076|Ga0184609_10191259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
3300018433|Ga0066667_10248125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
3300018476|Ga0190274_12930669 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300020580|Ga0210403_10582712 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300021432|Ga0210384_11485248 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021559|Ga0210409_11231962 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300021951|Ga0222624_1032923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
3300024284|Ga0247671_1033773 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300025901|Ga0207688_10553145 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300025901|Ga0207688_10967583 | Not Available | 538 | Open in IMG/M |
3300025908|Ga0207643_10229743 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300025911|Ga0207654_10928648 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300025916|Ga0207663_11395258 | Not Available | 564 | Open in IMG/M |
3300025934|Ga0207686_10034189 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
3300025934|Ga0207686_11252021 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300025934|Ga0207686_11787046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 509 | Open in IMG/M |
3300025937|Ga0207669_11655283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300025938|Ga0207704_11531918 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300025945|Ga0207679_11791065 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026023|Ga0207677_10976616 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300026035|Ga0207703_11368867 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300026089|Ga0207648_11124948 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300026142|Ga0207698_10065329 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
3300026221|Ga0209848_1066797 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300027639|Ga0209387_1119623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 664 | Open in IMG/M |
3300027846|Ga0209180_10689449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
3300027886|Ga0209486_10369420 | Not Available | 863 | Open in IMG/M |
3300027909|Ga0209382_10661647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
3300028380|Ga0268265_11861185 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031547|Ga0310887_10238780 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300031682|Ga0318560_10046318 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
3300031858|Ga0310892_10817374 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300031946|Ga0310910_10313880 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300031995|Ga0307409_102019639 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300032005|Ga0307411_11841162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 562 | Open in IMG/M |
3300032012|Ga0310902_10161599 | Not Available | 1279 | Open in IMG/M |
3300032051|Ga0318532_10257342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 620 | Open in IMG/M |
3300034690|Ga0364923_0112561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725004 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKC_03145910 | 2067725004 | Soil | AAGRTPISIADNLPVDLAVDLLTRLITERGDKPKIPSKR |
E4A_00701590 | 2170459003 | Grass Soil | PEVCEVIQYLADHHARLDELNEAGRTPMAIADNLPVDLAVDLLTKLITARGEKPKIPSKR |
ICChiseqgaiiFebDRAFT_137273321 | 3300000363 | Soil | NALSLADGLPVDLAVDLLTKLISESGSKPKIPSKR* |
JGI10215J12807_11611752 | 3300000881 | Soil | MNAAGRTPIALADGLPVDLAVDLLTKLITESGTTPKIPSKR* |
Ga0062595_1016626792 | 3300004479 | Soil | ADHGAKLDELNGAGRTPIAVADNLPVDMAVDLLTKLITARGEKPKIPSKR* |
Ga0062591_1001925392 | 3300004643 | Soil | MNAAGRTPIAIADNLPVDLAVDLLTKLITAQGGVPKIPSKR* |
Ga0070689_1004840382 | 3300005340 | Switchgrass Rhizosphere | EMNAANRTPISLADFSPVDKAVDLLTKLITERGGKPKIPSSR* |
Ga0070687_1013883471 | 3300005343 | Switchgrass Rhizosphere | ADHGAALDEMNAAGRTPIATADGLPVDMAVDILTKLITERGGKPKIPSRR* |
Ga0070669_1009530172 | 3300005353 | Switchgrass Rhizosphere | LDELNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPRIPSKR* |
Ga0070708_1009984332 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEMNGAGRTPIAIADGLPVDLAVDLLTKLITASGGKPKIPSKR* |
Ga0070706_1012321472 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | APLDELNGAGRTPMAIADNLPVDLAVDLLTRLLAAHGEKPKIPSRR* |
Ga0073909_104005822 | 3300005526 | Surface Soil | DEMNAAGRTPIAIADNLPVDLAVDLLTKLITAQGGVPKIPSKR* |
Ga0070697_1009139551 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AKLDEMNGAGRTPIAIADGLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0066693_104014252 | 3300005566 | Soil | HGALLDELNAAGRTPIAIADNLPVDLAVDLLTKLITERGGTPKIPSKR* |
Ga0068859_1024862772 | 3300005617 | Switchgrass Rhizosphere | DEMNAAGRTPIATADGLPVDMAVDILTKLITERGGKPKIPSRR* |
Ga0066905_1001805211 | 3300005713 | Tropical Forest Soil | DHGAKLDELNAAGRTPISMADTLPVDLAVDLLTKLLTERGVKPKIPSKR* |
Ga0066905_1013723882 | 3300005713 | Tropical Forest Soil | GAKLDEMNAAKRTPIAIADNLPVDLAVDLLTKLITARGDVPKIPSKR* |
Ga0066905_1020504331 | 3300005713 | Tropical Forest Soil | DELNGAGRTPIAVADNLPVDMAVDLLTKLITARGEKPKIPSKR* |
Ga0068861_1020180291 | 3300005719 | Switchgrass Rhizosphere | HGARLDELNAAGRTPISIADNLPVDLAVDLLTKLITAGGGKPKIPSKR* |
Ga0066651_102977122 | 3300006031 | Soil | LADHGARLDEMNGAGRTPIAIADNLPVDLAVDLLTRLITERGERPKIPSKR* |
Ga0075364_106612241 | 3300006051 | Populus Endosphere | VVQFLADRGAALDELDAAGRTPLSIADRLPVDRAVDLLTKLITDRGGKPKIPSNR* |
Ga0066660_100979872 | 3300006800 | Soil | RLDELNAAGRTPIAIADNLPVDLAVDLLTKLITERGEKPKIPSKR* |
Ga0075428_1005369391 | 3300006844 | Populus Rhizosphere | GAGRTPIAVADNLPVDMAVDLLTKLITARGEKPKIPSKR* |
Ga0075421_1005712163 | 3300006845 | Populus Rhizosphere | RGGKLDEMNAAGRTPISLADAQPVDLAVDLLTKMLSERGEKPKIPSKR* |
Ga0075421_1020311332 | 3300006845 | Populus Rhizosphere | RTPISIADNLPVDLAVDLLTKLITERGGVPKIPSKR* |
Ga0075434_1020380691 | 3300006871 | Populus Rhizosphere | GAGRTPIAIADNLPVDLAVDLLTRLIKERGGAPKIPSKR* |
Ga0075434_1021984371 | 3300006871 | Populus Rhizosphere | RTPISMADTLPVDLAVDLLTKLLTERGLKPKIPSKR* |
Ga0075434_1023964091 | 3300006871 | Populus Rhizosphere | PISIADGLPVDLAVDLLTKLMTARGETPKIPSKR* |
Ga0075434_1026550441 | 3300006871 | Populus Rhizosphere | RTPIAIADNLPVDLAVDLLTKLITERGEKPKIPSKR* |
Ga0079217_107817931 | 3300006876 | Agricultural Soil | ANRTPIALADGLPVDLAVDLLTKLITESGNKPKIPSKR* |
Ga0068865_1008766111 | 3300006881 | Miscanthus Rhizosphere | DELNGAGRTPIAIADNLPVDLAVDLLTKLITESGKKPKIPSKR* |
Ga0079215_105417051 | 3300006894 | Agricultural Soil | QPEVVEVMQFLADRGAKLDEMNAANRTPIALADGLPVDLAVDLLTKLITESGNKPKIPSKR* |
Ga0075424_1027029131 | 3300006904 | Populus Rhizosphere | DHGAKLDEMNGAGRTPISIADGLPVNLAVDLLTKLMTARGETPKIPSKR* |
Ga0075436_1012844342 | 3300006914 | Populus Rhizosphere | CEVIQYLADHGAKLDELNAAGRTPIAIADNLPVDLAVDLLTKLITARGEKPKIPSKR* |
Ga0075436_1015442421 | 3300006914 | Populus Rhizosphere | LNAAGRTPIAIADNLPVDLAVDLLTKLITARGEKPKIPSKR* |
Ga0079218_102126061 | 3300007004 | Agricultural Soil | FLADRGAKLDEMNAANRTPISLADGLPVDLAVDLLTKLITESGNTPKIPSKR* |
Ga0079218_107249451 | 3300007004 | Agricultural Soil | EMNAANRTPISLADGLPVDLAVDLLTKVITERGLKPKIPSKR* |
Ga0079218_116752621 | 3300007004 | Agricultural Soil | VMQFLADRGAKLDEMNAANRTPIALADGLPVDLAVDLLTKLITESGNKPKIPSKR* |
Ga0079218_137751302 | 3300007004 | Agricultural Soil | AGRTPISLAEPLPVDQAIDRLLKLLAERGEKPKIATKR* |
Ga0099827_108419791 | 3300009090 | Vadose Zone Soil | LDEMNGAGRTPIAIADGLPVDLAVDLLTRLITERGGRPKIPSKR* |
Ga0105247_106650683 | 3300009101 | Switchgrass Rhizosphere | LNGAGRTPMAIADNLPVDLAVDLLTRLITERGEKPKIPSKR* |
Ga0105247_115851662 | 3300009101 | Switchgrass Rhizosphere | LDELNDAGRTPMAIADNLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0105247_118813361 | 3300009101 | Switchgrass Rhizosphere | LDELNDAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR* |
Ga0066709_1037232922 | 3300009137 | Grasslands Soil | DHGALLDELNGAGRTPIAIADNLPVDLAVDLLTRLITARGGTPKIPSKR* |
Ga0114129_123667542 | 3300009147 | Populus Rhizosphere | AAGRTPIALAEPLPVDQAIDRLLKLLAERGEKPKIATKR* |
Ga0114129_125166001 | 3300009147 | Populus Rhizosphere | PISIADNLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0105243_107293082 | 3300009148 | Miscanthus Rhizosphere | LNGAGRTPMAIADNLPVDLAVDLLTKLITERGEKPKIPSKR* |
Ga0105243_120690011 | 3300009148 | Miscanthus Rhizosphere | DHRAKLDELNDAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR* |
Ga0111538_137917701 | 3300009156 | Populus Rhizosphere | GRTPIAVADNLPVDMAVDLLTKLITARGEKPKIPSKR* |
Ga0105100_103108052 | 3300009166 | Freshwater Sediment | KLDEMNAAGRTPIALADGQPVDLAVDLLTKLLTERGEKPKIPSRR* |
Ga0105248_106355172 | 3300009177 | Switchgrass Rhizosphere | TPIAVADNLPVDLAVDLLTKLITAQGGVPKIPSKR* |
Ga0105249_113189371 | 3300009553 | Switchgrass Rhizosphere | ADHGARLDELNAAGRTPISIADNLPVDLAVDLLTKLITAGGGKPKIPSKR* |
Ga0134080_106594421 | 3300010333 | Grasslands Soil | AGRTPIAIADNLPVDLAVDLLTRLITERGERPKIPSKR* |
Ga0134066_100287613 | 3300010364 | Grasslands Soil | AGRTPIAIADGLPVDLAVNLLTKLITARGETPKIPSKR* |
Ga0105239_107267582 | 3300010375 | Corn Rhizosphere | NDAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR* |
Ga0134124_115279982 | 3300010397 | Terrestrial Soil | DELNGAGRTPMAIADNLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0134122_122734011 | 3300010400 | Terrestrial Soil | IDEMNAAGRTPIALADGQPVDLAVDLLTKLITERGDKPKIPSRR* |
Ga0134121_131183982 | 3300010401 | Terrestrial Soil | LDELNGAGRTPMAIADNLPVDLAVDLLTKLITDRGEKPKIPSKR* |
Ga0150985_1066124221 | 3300012212 | Avena Fatua Rhizosphere | PMAIADNLPVDLAVDLLTKLITAAGDKPKIPSKR* |
Ga0137368_105046572 | 3300012358 | Vadose Zone Soil | LDELNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0137390_118496131 | 3300012363 | Vadose Zone Soil | EMNGAGRTPIAIADGLPVDLAVDLLTRLITERGGRPKIPSKR* |
Ga0137373_113179621 | 3300012532 | Vadose Zone Soil | PIAIADGLPVDLAVDLLTRLITERGGVPKIPSKR* |
Ga0157303_101310432 | 3300012896 | Soil | RGAKLDEMNAAGRTPIALADGLPVDLAVDLLTKLITESGTTPKIPSKR* |
Ga0137419_116032222 | 3300012925 | Vadose Zone Soil | DEMNGAGRTPIAIADGLPVDLAVDLLTKLITEHGGKPKIPSKR* |
Ga0137416_109072661 | 3300012927 | Vadose Zone Soil | LADHGARLDEMNGAGRTPIAIADGLPVDLAVDLLTRLITERGGSPKIPSKR* |
Ga0137410_111624141 | 3300012944 | Vadose Zone Soil | KLDEMNGAGRTPIAIADNLPVDLAVQLLTRLITERGGKPKIPSKR* |
Ga0137410_112836701 | 3300012944 | Vadose Zone Soil | PIAIADNLPVDLAVDLLTKLITERGGTPKIRSKR* |
Ga0164303_106681961 | 3300012957 | Soil | LDAAGRTPIVAADSLPVDQAVDLLTKLITDRGGKPKIASVR* |
Ga0164301_108841032 | 3300012960 | Soil | LNGAGRTPIAVADNLPVDMAVDLLTKLITARGEKPKIPSKR* |
Ga0126369_109704511 | 3300012971 | Tropical Forest Soil | LDEMNAARRTPIAVADNLPVDLAVDLLTKLLAERGEKPKIPSKR* |
Ga0134087_100015591 | 3300012977 | Grasslands Soil | LDELNATGRTPIAIADNLPVDLAVDLLTKLITERGEKPKIPSKR* |
Ga0164304_114435852 | 3300012986 | Soil | DELNAAGRTPIAIADNLPVDLAVDLLTKLITAHGDKPKIPSKR* |
Ga0164305_116775452 | 3300012989 | Soil | LDEMNGAGRTPIAVADNLPVDLAVDLLTKLLADRGEKPKIPSKR* |
Ga0157374_115394832 | 3300013296 | Miscanthus Rhizosphere | FLADHHAKLDELNGAGRTPMAIADNLPVDLAVDLLTKLITDRGEKPKIPSKR* |
Ga0157375_114905422 | 3300013308 | Miscanthus Rhizosphere | DELNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPKIPSKR* |
Ga0157375_134852061 | 3300013308 | Miscanthus Rhizosphere | AGRTPLVVADRLPVDRAVDLLTKLITERGGKPKVASVR* |
Ga0182036_111882151 | 3300016270 | Soil | AGRTPMAIADNLPVDLAVDLLTRLITERGEKPKIPSKR |
Ga0182033_100395194 | 3300016319 | Soil | GRTPIAIADNLPVDLAVNLLTKLIVSRGGVPKIPSKR |
Ga0182035_114402661 | 3300016341 | Soil | GRTPIAVADNLPVDLAVDLLTKLIKERGGVPKIPSKR |
Ga0182038_108490422 | 3300016445 | Soil | LDELNDAGRTPMAIADNLPVDLAVDLLTRLITERGEKPKIPSKR |
Ga0184605_104550271 | 3300018027 | Groundwater Sediment | LDELNGAGRTPIAIADGLPVDLAVDLLTKLITEGGGKPKIPSKR |
Ga0184609_101912592 | 3300018076 | Groundwater Sediment | MNRAGRTPIAIADGLPVDLAVDLLTRLITERGGVPKIPSKR |
Ga0066667_102481252 | 3300018433 | Grasslands Soil | GRTPIAIADNLPVDLAVDLLTKLITERGEKPKIPSKR |
Ga0190274_129306692 | 3300018476 | Soil | LNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPKIPSKR |
Ga0210403_105827121 | 3300020580 | Soil | HRARLDELNGAGRTPMAIADNLPVDLAVDLLTRLITGRGETPKIPSKR |
Ga0210384_114852482 | 3300021432 | Soil | ADHGALLDELNGAGRTPLAVADNLPVDLAVDLLTRLITARGGKPKIPSKR |
Ga0210409_112319621 | 3300021559 | Soil | TPLVIADRLPVDRAVDLLTKLITERGGKPKVASVR |
Ga0222624_10329231 | 3300021951 | Groundwater Sediment | HAKLDEMNGAGRTPIAIADGLPVDLAVDLLTKLITANGGKPKIPSKR |
Ga0247671_10337732 | 3300024284 | Soil | DELNAAKRTPISIADNLPVDLAVDLLTKLIRERGGTPKIPSKR |
Ga0207688_105531452 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRTPIAIADNLPVDLAVDLLTKLITERGGKPKIPSKR |
Ga0207688_109675831 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TPIVAADSLPVDQAVDLLTKLITDRGGKPKIASVR |
Ga0207643_102297431 | 3300025908 | Miscanthus Rhizosphere | LNAAGRTPISIADNLPVDLAVDLLTKLFTAGGGKPKIPSKR |
Ga0207654_109286482 | 3300025911 | Corn Rhizosphere | AKLDELNDAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR |
Ga0207663_113952581 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DAAGRTPIVAADSLPVDQAVDLLTKLITDRGGKPKIASVR |
Ga0207686_100341891 | 3300025934 | Miscanthus Rhizosphere | DAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR |
Ga0207686_112520212 | 3300025934 | Miscanthus Rhizosphere | VKPPTPAGRTPISIADNLPVDLAVDLLTKLITERGDKPKIPSKR |
Ga0207686_117870461 | 3300025934 | Miscanthus Rhizosphere | QFLADRGAKLDELNAAGRTPISIADNLPVDLAVDLLTKLINERGGVPKIPSKR |
Ga0207669_116552832 | 3300025937 | Miscanthus Rhizosphere | GAVLDELNGAGRTPIAIADGLPVDLAVDLLTKLITERGGTPKIPSKR |
Ga0207704_115319181 | 3300025938 | Miscanthus Rhizosphere | TPISIADNLPVDLAVDLLTKLITERGDKAKIPSKR |
Ga0207679_117910651 | 3300025945 | Corn Rhizosphere | LNGAGRTPIAIADNLPVDLAVDLLTKLITERGGKPRIPSKR |
Ga0207677_109766162 | 3300026023 | Miscanthus Rhizosphere | ADHGALLDELNAAGRTPIAIADNLPVDLAVDLLTKLITAHGDKPKIPSKR |
Ga0207703_113688671 | 3300026035 | Switchgrass Rhizosphere | DHGAKLDEMNGAGRTPIAIADNLPVDLAVDLLTKLITARGEKPKIPSKR |
Ga0207648_111249482 | 3300026089 | Miscanthus Rhizosphere | DELNDAGRTPMAIADNLPVDLAVDLLTRLLKERGEKPKIPSKR |
Ga0207698_100653291 | 3300026142 | Corn Rhizosphere | TPIAIADNLPVDLAVDLLTKLITAHGDTPKIPSKR |
Ga0209848_10667971 | 3300026221 | Permafrost Soil | LNGAGRTPIAIADNLPVDLAVDLLTRLITERGGKPRIPSKR |
Ga0209387_11196232 | 3300027639 | Agricultural Soil | QPEVVEVMQFLADRGAKLDEMNAANRTPIALADGLPVDLAVDLLTKLITESGNKPKIPSK |
Ga0209180_106894492 | 3300027846 | Vadose Zone Soil | MNGAGRTPIAIADNLPVDLAVDLLTRLITEHGGKPKIPSKR |
Ga0209486_103694201 | 3300027886 | Agricultural Soil | FLADRGAKLDEMNAANRTPISLADGLPVDLAVDLLTKLITESGNTPKIPSKR |
Ga0209382_106616473 | 3300027909 | Populus Rhizosphere | FIIDRGGKLDEMNAAGRTPISLADAQPVDLAVDLLTKMLSERGEKPKIPSKR |
Ga0268265_118611852 | 3300028380 | Switchgrass Rhizosphere | DHGARLDELNAAGRTPISIADNLPVDLAVDLLTKLITAGGGKPKIPSKR |
Ga0310887_102387801 | 3300031547 | Soil | LNAAGRTPISIADNLPVDLAVDLLTKLIAERGGVPKIPSKR |
Ga0318560_100463183 | 3300031682 | Soil | HGAELDALNNAGRTPIAIADNLPVDLAVTLLTKLIVSRGGVPKIPSKR |
Ga0310892_108173742 | 3300031858 | Soil | LNAAGRTPISVADNLPDDLAVDLLTKLITAGGGKPKIPSKR |
Ga0310910_103138801 | 3300031946 | Soil | ADQGARLDEMNAAGRTPISIADNLPVDLAVDLLTKLITERGGVPKIRSKR |
Ga0307409_1020196392 | 3300031995 | Rhizosphere | LADRGAKLDELNAAGRTPIALAEPLPVDQAIDRLLKLLAERGEKPKIAPKR |
Ga0307411_118411622 | 3300032005 | Rhizosphere | QFLADRGAKLDELNAAGRTPIALAEPLPVDQAIDRLLKLLAERGEKPKIAPKR |
Ga0310902_101615991 | 3300032012 | Soil | TAGRTPIALAEPLPVDQAIDRLLKLLAERGEKPKIATKR |
Ga0318532_102573422 | 3300032051 | Soil | TQPQVCEVIQYLADQGASLDEMNAAGRTPISIADNLPVDLAVDLLTKLITERGGVPKIRSKR |
Ga0364923_0112561_3_110 | 3300034690 | Sediment | TPLAAADGLPVDQAVDLLTKLITDRGGKPKIPSKR |
⦗Top⦘ |