NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074531

Metagenome / Metatranscriptome Family F074531

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074531
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 42 residues
Representative Sequence GPAIAKGVDVLKKGGVCVIDFHVDPPAERQASHALGHRATGD
Number of Associated Samples 109
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.16 %
% of genes from short scaffolds (< 2000 bps) 89.08 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.193 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(25.210 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 0.00%    Coil/Unstructured: 78.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF06155GBBH-like_N 31.09
PF00892EamA 19.33
PF11150DUF2927 19.33
PF05685Uma2 1.68
PF01039Carboxyl_trans 1.68
PF03734YkuD 1.68
PF01794Ferric_reduct 0.84
PF04392ABC_sub_bind 0.84
PF02775TPP_enzyme_C 0.84
PF05598DUF772 0.84
PF00902TatC 0.84
PF00903Glyoxalase 0.84
PF12616DUF3775 0.84
PF13594Obsolete Pfam Family 0.84
PF00982Glyco_transf_20 0.84
PF01135PCMT 0.84
PF02776TPP_enzyme_N 0.84
PF13546DDE_5 0.84
PF02321OEP 0.84
PF13751DDE_Tnp_1_6 0.84
PF01266DAO 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 31.09
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 1.68
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 1.68
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 1.68
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.68
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 1.68
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.68
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 1.68
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.84
COG0805Twin-arginine protein secretion pathway component TatCIntracellular trafficking, secretion, and vesicular transport [U] 0.84
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.84
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.84
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.84
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.84
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.19 %
UnclassifiedrootN/A16.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004114|Ga0062593_101112527All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M
3300004281|Ga0066397_10145609All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300005341|Ga0070691_10080648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1593Open in IMG/M
3300005578|Ga0068854_100032407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3637Open in IMG/M
3300005618|Ga0068864_100608167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1061Open in IMG/M
3300005712|Ga0070764_10967418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300005713|Ga0066905_100122930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1815Open in IMG/M
3300005764|Ga0066903_106685807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales600Open in IMG/M
3300005764|Ga0066903_107549952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales561Open in IMG/M
3300006050|Ga0075028_100016418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3183Open in IMG/M
3300006052|Ga0075029_100636874All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300006844|Ga0075428_102519618All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006847|Ga0075431_100343182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1502Open in IMG/M
3300006914|Ga0075436_100862655All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300009156|Ga0111538_10521006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1506Open in IMG/M
3300009162|Ga0075423_11832791Not Available655Open in IMG/M
3300009252|Ga0103863_10076286Not Available504Open in IMG/M
3300009633|Ga0116129_1247426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300009645|Ga0116106_1020787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2305Open in IMG/M
3300009684|Ga0114958_10411742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300009824|Ga0116219_10163198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_781285Open in IMG/M
3300010037|Ga0126304_10273543All Organisms → cellular organisms → Bacteria → Proteobacteria1115Open in IMG/M
3300010042|Ga0126314_11193034Not Available568Open in IMG/M
3300010046|Ga0126384_11045807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales746Open in IMG/M
3300010048|Ga0126373_10780764Not Available1016Open in IMG/M
3300010049|Ga0123356_10243199All Organisms → cellular organisms → Bacteria → Proteobacteria1872Open in IMG/M
3300010049|Ga0123356_10377632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → unclassified Caulobacteraceae → Caulobacteraceae bacterium1549Open in IMG/M
3300010049|Ga0123356_13778317Not Available523Open in IMG/M
3300010159|Ga0099796_10460616Not Available567Open in IMG/M
3300010359|Ga0126376_11312831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales744Open in IMG/M
3300010361|Ga0126378_13033532All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010362|Ga0126377_13047525All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010366|Ga0126379_10697057All Organisms → cellular organisms → Bacteria → Proteobacteria1109Open in IMG/M
3300010379|Ga0136449_101826740Not Available908Open in IMG/M
3300011119|Ga0105246_12473118Not Available511Open in IMG/M
3300011269|Ga0137392_11318443All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012212|Ga0150985_115520553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2350Open in IMG/M
3300012212|Ga0150985_119443474Not Available673Open in IMG/M
3300012357|Ga0137384_10016971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5919Open in IMG/M
3300012361|Ga0137360_11753479Not Available526Open in IMG/M
3300012469|Ga0150984_121136577All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300012924|Ga0137413_11168858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales612Open in IMG/M
3300012948|Ga0126375_10839557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales732Open in IMG/M
3300012957|Ga0164303_10448326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria811Open in IMG/M
3300012984|Ga0164309_11970361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300013297|Ga0157378_10302635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1548Open in IMG/M
3300013308|Ga0157375_11475129Not Available802Open in IMG/M
3300014326|Ga0157380_13114130Not Available529Open in IMG/M
3300014489|Ga0182018_10568934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300014499|Ga0182012_10324476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_781033Open in IMG/M
3300014501|Ga0182024_10160442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3140Open in IMG/M
3300014657|Ga0181522_10277472All Organisms → cellular organisms → Bacteria → Proteobacteria993Open in IMG/M
3300015242|Ga0137412_10747197Not Available723Open in IMG/M
3300015371|Ga0132258_10379907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3503Open in IMG/M
3300016294|Ga0182041_11312071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales662Open in IMG/M
3300016357|Ga0182032_11849485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300016422|Ga0182039_12174974All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300016750|Ga0181505_10861592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2267Open in IMG/M
3300017970|Ga0187783_10816816Not Available672Open in IMG/M
3300018056|Ga0184623_10467861All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018058|Ga0187766_11369152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300018073|Ga0184624_10289575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales734Open in IMG/M
3300018429|Ga0190272_10454039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1069Open in IMG/M
3300018429|Ga0190272_10563184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales988Open in IMG/M
3300018432|Ga0190275_13605116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300018465|Ga0190269_10416093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales838Open in IMG/M
3300019884|Ga0193741_1081410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae832Open in IMG/M
3300021073|Ga0210378_10252884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales667Open in IMG/M
3300021080|Ga0210382_10254966Not Available768Open in IMG/M
3300021090|Ga0210377_10427139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales781Open in IMG/M
3300021181|Ga0210388_10322598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1358Open in IMG/M
3300021181|Ga0210388_10526355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_781037Open in IMG/M
3300021181|Ga0210388_11735860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300021401|Ga0210393_11481213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300021405|Ga0210387_10334358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601336Open in IMG/M
3300021405|Ga0210387_11822371Not Available512Open in IMG/M
3300021407|Ga0210383_10407811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_781172Open in IMG/M
3300021479|Ga0210410_10257051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1567Open in IMG/M
3300025500|Ga0208686_1012916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2287Open in IMG/M
3300025936|Ga0207670_11654797All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025981|Ga0207640_10078903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2242Open in IMG/M
3300026557|Ga0179587_10736233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales650Open in IMG/M
3300027383|Ga0209213_1026414All Organisms → cellular organisms → Bacteria → Proteobacteria1094Open in IMG/M
3300027384|Ga0209854_1019510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1095Open in IMG/M
3300027619|Ga0209330_1116973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300027645|Ga0209117_1034535All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300027646|Ga0209466_1130933Not Available510Open in IMG/M
3300027662|Ga0208565_1109576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_78826Open in IMG/M
3300027855|Ga0209693_10344685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300027884|Ga0209275_10706587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300027915|Ga0209069_10054686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1880Open in IMG/M
3300028707|Ga0307291_1017885All Organisms → cellular organisms → Bacteria → Proteobacteria1589Open in IMG/M
3300028720|Ga0307317_10015065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2331Open in IMG/M
3300028768|Ga0307280_10065861All Organisms → cellular organisms → Bacteria → Proteobacteria1157Open in IMG/M
3300028782|Ga0307306_10165077Not Available621Open in IMG/M
3300028793|Ga0307299_10313174Not Available589Open in IMG/M
3300028824|Ga0307310_10423194Not Available663Open in IMG/M
3300028889|Ga0247827_10296620All Organisms → cellular organisms → Bacteria → Proteobacteria941Open in IMG/M
3300028906|Ga0308309_10561016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_78990Open in IMG/M
3300028906|Ga0308309_11229080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300028906|Ga0308309_11790652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300030521|Ga0307511_10399302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales566Open in IMG/M
3300031561|Ga0318528_10536911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300031681|Ga0318572_10428991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis786Open in IMG/M
3300031708|Ga0310686_118443244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2317Open in IMG/M
3300031744|Ga0306918_11521573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales511Open in IMG/M
3300031782|Ga0318552_10497829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300031894|Ga0318522_10240697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300031896|Ga0318551_10729629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales575Open in IMG/M
3300031945|Ga0310913_10420763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis948Open in IMG/M
3300032012|Ga0310902_11056421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis566Open in IMG/M
3300032075|Ga0310890_10266497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense → Nitrospirillum amazonense Y21214Open in IMG/M
3300032076|Ga0306924_10464505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1445Open in IMG/M
3300032094|Ga0318540_10366613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales696Open in IMG/M
3300032180|Ga0307471_103438566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300032205|Ga0307472_100491286All Organisms → cellular organisms → Bacteria → Proteobacteria1055Open in IMG/M
3300032261|Ga0306920_100412659All Organisms → cellular organisms → Bacteria2007Open in IMG/M
3300032805|Ga0335078_10686887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1271Open in IMG/M
3300033828|Ga0334850_109792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.04%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.20%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.20%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.52%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut2.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.68%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.84%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.84%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.84%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009252Microbial communities of water from Amazon river, Brazil - RCM16EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062593_10111252713300004114SoilDVKAAISKGVSVLKAGGVCVIDFHIDPGEERAAGAALGHRPTGN*
Ga0066397_1014560923300004281Tropical Forest SoilADADAAIAKGVDVLKKGGVCVIDFHVDPPADRQTNHGLGHRATGQ*
Ga0070691_1008064813300005341Corn, Switchgrass And Miscanthus RhizosphereKAAISKGVAVLKSGGVCVIDFHVEPPAERSDGIGHRPTAA*
Ga0068854_10003240713300005578Corn RhizosphereKAAISKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA*
Ga0068864_10060816713300005618Switchgrass RhizosphereAADAASAIAKGVDVLKKGGVCVIDFHVDPSAERQANHGLGHRATND*
Ga0070764_1096741813300005712SoilIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE*
Ga0066905_10012293013300005713Tropical Forest SoilAISRGVSVLKSGGVCVIDFHVEPPPERSDGIGQRATSD*
Ga0066903_10668580713300005764Tropical Forest SoilVDVLKKGGVCVIDFHVDPPADRQTNHGLGHRATGE*
Ga0066903_10754995223300005764Tropical Forest SoilKAAISRGVTVLKSGGVCVIDFHVEPPPERSDGIGQRGSGD*
Ga0075028_10001641853300006050WatershedsAILKKGGVCVIDFHVDPPAERQAISALGHRETGY*
Ga0075029_10063687413300006052WatershedsALEKGVAILKKGGVCVIDFHVDPPAERQAISALGHRETGY*
Ga0075428_10251961823300006844Populus RhizosphereTSQADAKAAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGFRATN*
Ga0075431_10034318233300006847Populus RhizosphereTAAEVGAAISQGVAVLKSGGVCVIDFHVDPPPERSDGIGHRATGG*
Ga0075436_10086265523300006914Populus RhizosphereVKTAAEVKAAISKGVAVLKSGGVCVIDFHVEPPAERSDGIGHRPTAA*
Ga0111538_1052100613300009156Populus RhizosphereAAEVKAAISKGVAVLKSGGVCVIDFHVEPPAERSDGIGHRPTAA*
Ga0075423_1183279113300009162Populus RhizosphereGVAVLKKGGVCVVDLHVTPGAERQAHSALGHRATAD*
Ga0103863_1007628613300009252River WaterSAIARGVDILKKGGVCVIDFHVDPPAERQANHGLGHRATGE*
Ga0116129_124742623300009633PeatlandVDVLKKGGVCVIDLHIDPPSERQASHALGHRATGD*
Ga0116106_102078743300009645PeatlandPVTKASDVNAAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE*
Ga0114958_1041174213300009684Freshwater LakeAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE*
Ga0116219_1016319833300009824Peatlands SoilSDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE*
Ga0126304_1027354313300010037Serpentine SoilLEDARAAIVKGVDVLKKGGVCVIDFHIDPPAERQAAHNLGFRATGDAAAH*
Ga0126314_1119303413300010042Serpentine SoilEVDAAIEKGVAVLRSGGVCVIDFHIDPGEERHATAALGQRATGG*
Ga0126384_1104580723300010046Tropical Forest SoilGVSVLKAGGVCVIDFHVDPPPERSDGIAQRGTGD*
Ga0126373_1078076433300010048Tropical Forest SoilDVKGALEKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY*
Ga0123356_1024319933300010049Termite GutIEKGVDVLKKGGVCVIDLHIDPPAERQASHALGHRATAE*
Ga0123356_1037763213300010049Termite GutPAIEKGVDVLKKGGVCVIDLHIDPPAERQASHALGHRATTAT*
Ga0123356_1377831713300010049Termite GutPAIEKGVDVLKKGGVCVIDLHIDPPAERQASHALGHRATTA*
Ga0099796_1046061613300010159Vadose Zone SoilKTAAEVKAAISKGVAVLKSGGVCVIDFHVDPPPERSDGIGHRPTGA*
Ga0126376_1131283113300010359Tropical Forest SoilVDVLKKGGVCVIDFHVDPPAERQANHGLGHRATGETG*
Ga0126378_1303353213300010361Tropical Forest SoilALEKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY*
Ga0126377_1304752513300010362Tropical Forest SoilDAAPAIAKGVDVLKKGGVCVIDFHVDPPAERQANHGLGHRATGG*
Ga0126379_1069705733300010366Tropical Forest SoilAIAKGVSVLKAGGVCVIDFHVDPPPERSDGIAQRGTGD*
Ga0136449_10182674013300010379Peatlands SoilRGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE*
Ga0105246_1247311813300011119Miscanthus RhizospherePVKTAAEVKAAISKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA*
Ga0137392_1131844313300011269Vadose Zone SoilTAAADVKAAISKGVSVLKSGGVCVIDFHIDPGEERAAGAALGHRPTGN*
Ga0150985_11552055333300012212Avena Fatua RhizosphereVTSAADAAAAIAKGVDVLKKGGVCVIDFHVDPPADRQTNHGLGHRATND*
Ga0150985_11944347413300012212Avena Fatua RhizosphereAELPAAISRAVSVLKSDGVCVVDFHVAPPAERTDGIGDRPTGP*
Ga0137384_1001697183300012357Vadose Zone SoilVKAAIEKGVAVLKQGGVCVIDFHVDPPAERQASHGLGHRATGD*
Ga0137360_1175347913300012361Vadose Zone SoilTTAAEVKAAISRGVAVLKSGGVCVIDFHVTPPAERSDGIGQRATGS*
Ga0150984_12113657723300012469Avena Fatua RhizosphereSKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA*
Ga0137413_1116885813300012924Vadose Zone SoilTKASYVAAAIAKGVDVLKKGGVCVIDFHVEPPAERQAGHALGYRATGNQPPKA*
Ga0126375_1083955713300012948Tropical Forest SoilAADSAAAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGYRATN*
Ga0164303_1044832613300012957SoilADAAAAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGYRATGNASG*
Ga0164309_1197036113300012984SoilDAAAAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGYRATGNSTG*
Ga0157378_1030263513300013297Miscanthus RhizosphereTAAEVKAAISKGVAVLKSGGVCVIDFHVEPPAERSDGIGHRPTAA*
Ga0157375_1147512913300013308Miscanthus RhizosphereAAIAKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTGA*
Ga0157380_1311413023300014326Switchgrass RhizosphereVKAAISKGVAVLKSGGVCVIDFHVEPPPERSDGSGHRPTAA*
Ga0182018_1056893413300014489PalsaAALEKGVAILKKGGVCVIDFHVDPPAERAAVSALGHRETGY*
Ga0182012_1032447623300014499BogVTKPEDVAPAIARGVDVLKKGGVCVIDLHIDPPSERQASHALGHRATGD*
Ga0182024_1016044213300014501PermafrostDVKAAIEKGVDVLKKGGVCVIDLHVDPPAERQSSHALGHRATGE*
Ga0181522_1027747213300014657BogALEKGVAILKKGGVCVIDFQVDPPAERAAISALGHRETGY*
Ga0137412_1074719713300015242Vadose Zone SoilISKGVAVLKSGGVCVIDFHVEPPPERSDGIGQRATGD*
Ga0132258_1037990713300015371Arabidopsis RhizosphereAEVGAAISRGVAVLKSGGVCVIDFHVDPPPERSDGIGHRATGG*
Ga0182041_1131207113300016294SoilKGVDVLKKGGVCVIDFHVDPPAERQASHALGHRATGD
Ga0182032_1184948513300016357SoilALEKGVAILKQGGVCVIDFQVDPPVERQEISALGHRETGY
Ga0182039_1217497413300016422SoilGVAILKKGGVCVIDFHVDPPVERQEISALGHRETGY
Ga0181505_1086159213300016750PeatlandIARGVDVLKKGGVCVIDLHVNPPSERQASHALGHRATGE
Ga0187783_1081681613300017970Tropical PeatlandTKAADVTPAIAKGVDVLKKGGVCVIDLHVDPPAERQSSHALGHRATGE
Ga0184623_1046786113300018056Groundwater SedimentAIAKGVSVLKSGGVCVIDFHVEPPPERSDGIGHRATGG
Ga0187766_1136915223300018058Tropical PeatlandNKAEDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0184624_1028957533300018073Groundwater SedimentADVRAAIARGVSVLKSGGVCVIDFHIDPGEERAAGAALGHRPTGD
Ga0190272_1045403933300018429SoilAAIAKGVSVLKSGGVCVIDFHVEPPPERSDGIGHRATGG
Ga0190272_1056318433300018429SoilAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGFRATN
Ga0190275_1360511623300018432SoilAIAKGVDVLKKGGVCVIDFHIDPPAERQANHGLGYRATGASSPEVTG
Ga0190269_1041609333300018465SoilAIAKGVDILKKGGVCVIYFHIEPPMERQANHGLGFRATGN
Ga0193741_108141033300019884SoilTSQADAKAAIAKGVDVLKKGGVCVIDFHVEPPAERQANHGLGYRATN
Ga0210378_1025288413300021073Groundwater SedimentGVSVLKSGGVCVIDFHIDPGEERAAGAALGHRPTGD
Ga0210382_1025496623300021080Groundwater SedimentRTAIAKGVDVLKKGGICVIDFHIDPPAERQAAHNLGFRATGNAAGN
Ga0210377_1042713933300021090Groundwater SedimentDAKAAIAKGVDVLKKGGVCVIDFHVDPPAERQANHGLGHRATGD
Ga0210388_1032259813300021181SoilRGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0210388_1052635513300021181SoilAAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0210388_1173586013300021181SoilPAIARGVNVLKKGGVCVIDLHIDPPSERQASHALGHRATGD
Ga0210393_1148121323300021401SoilAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0210387_1033435833300021405SoilPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0210387_1182237113300021405SoilSDVKAALEKGVAILKQGGVCVIDFHVDPPAERQAISALGHRETGY
Ga0210383_1040781113300021407SoilDVNAAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0210410_1025705133300021479SoilPVTKAADVKPALEKGVAILKKGGVCVIDFHVDPPAERQAISALGHRETGY
Ga0208686_101291643300025500PeatlandDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0207670_1165479723300025936Switchgrass RhizosphereKGVDVLKKGGVCVIDFHVEPPAERQANHGLGYRAIN
Ga0207640_1007890313300025981Corn RhizosphereAAISKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA
Ga0179587_1073623313300026557Vadose Zone SoilSDVKAALEKGVAILKKGGVCVIDFYVDPPAERQAISALGHRETGY
Ga0209213_102641423300027383Forest SoilKAAISKGVAVLKSGGVCVIDFHVEPPAERTDGIGHRATGG
Ga0209854_101951013300027384Groundwater SandDVLKKGGVCVIDFHVAPPAERQASHGLGHRATGEATG
Ga0209330_111697313300027619Forest SoilADVASAIARGVDVLKKGGVCVIDLHVDPPAERQASHALGHRATGE
Ga0209117_103453513300027645Forest SoilKAADVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0209466_113093313300027646Tropical Forest SoilTSPADADAAIAKGVDVLKKGGVCVIDFHVDPPADRQTNHGLGHRATGQ
Ga0208565_110957623300027662Peatlands SoilVTKASDVAPAIARGVDVLKKGGVCVIDLHVNPPSERQASHALGHRATGE
Ga0209693_1034468523300027855SoilPVTKASDVSAAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0209275_1070658723300027884SoilPVTKPEDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGG
Ga0209069_1005468613300027915WatershedsEKGVAILKKGGVCVIDFHVDPPAERQAISALGHRETGY
Ga0307291_101788513300028707SoilKAAISKGVAVLKSGGVCVIDFHVDPPPERSDGIGHRPTGA
Ga0307317_1001506553300028720SoilAAEVKAAISKGVAVLKSGGVCVIDFHVDPPPERSDGIGHRPTGA
Ga0307280_1006586123300028768SoilKGVAVLKSGGVCVIDFHVDPPPERSDGIGHRPTGA
Ga0307306_1016507713300028782SoilVKTAAEVKAAISKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA
Ga0307299_1031317413300028793SoilEVKAAISKGVAVLKSGGVCVIDFHVEPPPERSDGIGHRPTAA
Ga0307310_1042319413300028824SoilAISKGVSVLKSGGVCVIDFHVEPPAERTDGIGHRATGG
Ga0247827_1029662013300028889SoilVKAAISKGVAVLKSGGVCVIDFHVEPPAERSDGIGHRPTAA
Ga0308309_1056101613300028906SoilSAAIAHGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0308309_1122908023300028906SoilGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0308309_1179065223300028906SoilVGPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0307511_1039930223300030521EctomycorrhizaKGVDVLKKGGVCVIDFHVDPPADRQTNHGLGHRATND
Ga0318528_1053691113300031561SoilVTRTEDVTPAIARGVDVLKKGGVCVIDLHVDPPSERQTSHALGHRATGE
Ga0318572_1042899123300031681SoilVKPTLEKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY
Ga0310686_11844324443300031708SoilPVTRPEDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGD
Ga0306918_1152157313300031744SoilGPAIAKGVDVLKKGGVCVIDFHVDPPAERQASHALGHRATGD
Ga0318552_1049782923300031782SoilPSDVAPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGE
Ga0318522_1024069713300031894SoilTRTEDVTPAIARGVDVLKKGGVCVIDLHVDPPSERQTSHALGHRATGE
Ga0318551_1072962913300031896SoilKAADVKPALEKGVVILKQGGVCVIDFHVDPPPERAVISALGHRETGY
Ga0310913_1042076323300031945SoilKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY
Ga0310902_1105642113300032012SoilEAIAKGVDVLKKGGVCVIDFHIDPPSERQAAHNLGFRATGG
Ga0310890_1026649723300032075SoilEDARAAIAKGVDVLKKGGVCVIDFHIDPPAERQANHGLGYRATG
Ga0306924_1046450533300032076SoilVDVLKKGGVCVIDFHVDPPAERLASHALGHRATGGA
Ga0318540_1036661313300032094SoilVKPALEKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY
Ga0307471_10343856613300032180Hardwood Forest SoilLQAAISKGVSVLKSGGVCVIDFHVEPPADRSDGIGHRPTGD
Ga0307472_10049128613300032205Hardwood Forest SoilRTAAEVGAAISQGVAVLKSGGVCVIDFHVDPPPERSDGIGHRPTGG
Ga0306920_10041265913300032261SoilGPITKAADVKPALEKGVAILKQGGVCVIDFHVDPPPERAVISALGHRETGY
Ga0335078_1068688713300032805SoilVKPAIEKGVDALKKGGVCVIDFHIDPPAERQASHALGHRATGG
Ga0334850_109792_3_1283300033828SoilPAIARGVDVLKKGGVCVIDLHVDPPSERQASHALGHRATGD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.