NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074388

Metagenome Family F074388

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074388
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 95 residues
Representative Sequence MKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Number of Associated Samples 71
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.55 %
% of genes near scaffold ends (potentially truncated) 22.69 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(34.454 % of family members)
Environment Ontology (ENVO) Unclassified
(51.261 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(36.975 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.38%    β-sheet: 41.67%    Coil/Unstructured: 48.96%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00589Phage_integrase 1.68
PF13604AAA_30 0.84
PF00216Bac_DNA_binding 0.84
PF13365Trypsin_2 0.84
PF03235DUF262 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.84
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001580|Draft_10017156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5710Open in IMG/M
3300003432|JGI20214J51088_10063158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2586Open in IMG/M
3300003432|JGI20214J51088_10526154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium757Open in IMG/M
3300003541|JGI20214J51650_10340170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1043Open in IMG/M
3300004049|Ga0055493_10070236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium702Open in IMG/M
3300004088|Ga0051987_10170421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium755Open in IMG/M
3300004149|Ga0066632_10060942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1295Open in IMG/M
3300004212|Ga0066631_10267170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium766Open in IMG/M
3300004238|Ga0066635_10143996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1132Open in IMG/M
3300004481|Ga0069718_16320801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1452Open in IMG/M
3300005573|Ga0078972_1215999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium817Open in IMG/M
3300008001|Ga0100389_1113058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1405Open in IMG/M
3300008002|Ga0100390_10368879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium679Open in IMG/M
3300008009|Ga0100394_1153400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1172Open in IMG/M
3300009004|Ga0100377_1137443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1022Open in IMG/M
3300009039|Ga0105152_10319100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium648Open in IMG/M
3300009039|Ga0105152_10505367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium516Open in IMG/M
3300009082|Ga0105099_10657808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium647Open in IMG/M
3300009082|Ga0105099_10902870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium558Open in IMG/M
3300009087|Ga0105107_10547055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium806Open in IMG/M
3300009111|Ga0115026_11842699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium514Open in IMG/M
3300009153|Ga0105094_10624512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium629Open in IMG/M
3300009153|Ga0105094_10669596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium607Open in IMG/M
3300009167|Ga0113563_11364183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium831Open in IMG/M
3300009169|Ga0105097_10397147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium766Open in IMG/M
3300009503|Ga0123519_10198114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1402Open in IMG/M
3300009504|Ga0114946_10033167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium3021Open in IMG/M
3300009504|Ga0114946_10043002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2609Open in IMG/M
3300009504|Ga0114946_10328130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium803Open in IMG/M
3300009504|Ga0114946_10666876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium523Open in IMG/M
3300010319|Ga0136653_10053135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2028Open in IMG/M
3300013088|Ga0163200_1036492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1485Open in IMG/M
3300013090|Ga0163209_1288168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium562Open in IMG/M
3300013092|Ga0163199_1209419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium761Open in IMG/M
3300013092|Ga0163199_1268803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium650Open in IMG/M
3300013092|Ga0163199_1315705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium589Open in IMG/M
3300013092|Ga0163199_1367802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium536Open in IMG/M
(restricted) 3300013122|Ga0172374_1098533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1120Open in IMG/M
(restricted) 3300013123|Ga0172368_10246536All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium879Open in IMG/M
(restricted) 3300013123|Ga0172368_10422950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium595Open in IMG/M
(restricted) 3300013125|Ga0172369_10108152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1793Open in IMG/M
(restricted) 3300013131|Ga0172373_10247993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1177Open in IMG/M
(restricted) 3300013136|Ga0172370_10357080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium820Open in IMG/M
(restricted) 3300013137|Ga0172375_10024919All Organisms → cellular organisms → Bacteria → Proteobacteria6645Open in IMG/M
(restricted) 3300013137|Ga0172375_10042459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium4577Open in IMG/M
(restricted) 3300013137|Ga0172375_10276662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1234Open in IMG/M
(restricted) 3300013137|Ga0172375_10525659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium782Open in IMG/M
(restricted) 3300013137|Ga0172375_10688548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium646Open in IMG/M
(restricted) 3300013137|Ga0172375_10723733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium624Open in IMG/M
3300013391|Ga0180014_1018020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium821Open in IMG/M
3300014316|Ga0075339_1209623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium553Open in IMG/M
3300014319|Ga0075348_1084347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium779Open in IMG/M
3300014502|Ga0182021_11068033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium972Open in IMG/M
3300014502|Ga0182021_11482832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium817Open in IMG/M
3300018055|Ga0184616_10124006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium938Open in IMG/M
3300018070|Ga0184631_10095623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1152Open in IMG/M
3300022553|Ga0212124_10164749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1215Open in IMG/M
3300022553|Ga0212124_10248897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium952Open in IMG/M
3300022553|Ga0212124_10254754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium939Open in IMG/M
3300022556|Ga0212121_10311531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1060Open in IMG/M
(restricted) 3300023177|Ga0233423_10000595All Organisms → cellular organisms → Bacteria → Proteobacteria18682Open in IMG/M
3300023311|Ga0256681_11804034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium661Open in IMG/M
3300025017|Ga0210022_1052428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1395Open in IMG/M
3300025022|Ga0210056_1103765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1125Open in IMG/M
3300025135|Ga0209498_1039063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2241Open in IMG/M
3300025135|Ga0209498_1145115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium907Open in IMG/M
3300025135|Ga0209498_1233748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium651Open in IMG/M
3300026057|Ga0208294_1028629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium638Open in IMG/M
3300027723|Ga0209703_1176715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium793Open in IMG/M
3300027863|Ga0207433_10178248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1683Open in IMG/M
3300027897|Ga0209254_10498641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium880Open in IMG/M
3300027897|Ga0209254_10683895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium710Open in IMG/M
3300027897|Ga0209254_10952484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium564Open in IMG/M
3300027902|Ga0209048_10158353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1682Open in IMG/M
3300028176|Ga0268284_1080658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium840Open in IMG/M
3300028298|Ga0268280_1042852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1333Open in IMG/M
3300031552|Ga0315542_1000055All Organisms → cellular organisms → Bacteria54174Open in IMG/M
3300031552|Ga0315542_1307277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium540Open in IMG/M
3300031746|Ga0315293_10622253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium815Open in IMG/M
3300031834|Ga0315290_10177249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1845Open in IMG/M
3300031834|Ga0315290_10949490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium727Open in IMG/M
3300031834|Ga0315290_11105790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium662Open in IMG/M
3300031834|Ga0315290_11533402All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium540Open in IMG/M
3300031873|Ga0315297_10396288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1157Open in IMG/M
3300031873|Ga0315297_10588818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium934Open in IMG/M
3300031873|Ga0315297_11002650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium690Open in IMG/M
3300031873|Ga0315297_11356050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium578Open in IMG/M
3300031873|Ga0315297_11607932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium522Open in IMG/M
3300031952|Ga0315294_11467603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium536Open in IMG/M
3300031997|Ga0315278_11017524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium824Open in IMG/M
3300031997|Ga0315278_11378222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium683Open in IMG/M
3300031997|Ga0315278_11825594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium573Open in IMG/M
3300031999|Ga0315274_10869345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium944Open in IMG/M
3300032143|Ga0315292_11635217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium518Open in IMG/M
3300032156|Ga0315295_11166477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium757Open in IMG/M
3300032163|Ga0315281_11962391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium560Open in IMG/M
3300032164|Ga0315283_10680436All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1109Open in IMG/M
3300032164|Ga0315283_11136030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium819Open in IMG/M
3300032173|Ga0315268_10051740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3888Open in IMG/M
3300032173|Ga0315268_10569341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1122Open in IMG/M
3300032177|Ga0315276_10201885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2086Open in IMG/M
3300032177|Ga0315276_10550441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1240Open in IMG/M
3300032177|Ga0315276_10991346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium893Open in IMG/M
3300032177|Ga0315276_11527060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium694Open in IMG/M
3300032177|Ga0315276_12123007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium570Open in IMG/M
3300032275|Ga0315270_10146217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1419Open in IMG/M
3300032342|Ga0315286_10709930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1026Open in IMG/M
3300032342|Ga0315286_10992933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium835Open in IMG/M
3300032342|Ga0315286_11159489All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium758Open in IMG/M
3300032397|Ga0315287_10548494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1371Open in IMG/M
3300032397|Ga0315287_11130433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium905Open in IMG/M
3300032397|Ga0315287_11844042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium671Open in IMG/M
3300032401|Ga0315275_12217414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium574Open in IMG/M
3300032516|Ga0315273_10381114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1903Open in IMG/M
3300032516|Ga0315273_11165630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium973Open in IMG/M
3300032516|Ga0315273_11568655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium805Open in IMG/M
3300032516|Ga0315273_11675049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium772Open in IMG/M
3300032516|Ga0315273_11902326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium711Open in IMG/M
3300032516|Ga0315273_12548807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium588Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment34.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.88%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment5.88%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater5.04%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer4.20%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.36%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.52%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring2.52%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.52%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water1.68%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment1.68%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.68%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.68%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.68%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.84%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.84%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004088Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/10/14 0.8 um filterEnvironmentalOpen in IMG/M
3300004149Groundwater microbial communities from aquifer - Crystal Geyser CG03_land_8/20/14_0.80EnvironmentalOpen in IMG/M
3300004212Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00EnvironmentalOpen in IMG/M
3300004238Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005573Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)EnvironmentalOpen in IMG/M
3300008001Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13EnvironmentalOpen in IMG/M
3300008002Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14EnvironmentalOpen in IMG/M
3300008009Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18EnvironmentalOpen in IMG/M
3300009004Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01EnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300010319Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaGEnvironmentalOpen in IMG/M
3300013088Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200mEnvironmentalOpen in IMG/M
3300013090Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160mEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013122 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3mEnvironmentalOpen in IMG/M
3300013123 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11mEnvironmentalOpen in IMG/M
3300013125 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013136 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013391Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S1_MetaGEnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300022556Kivu_combined assemblyEnvironmentalOpen in IMG/M
3300023177 (restricted)Freshwater microbial communities from Lake Matano, South Sulawesi, Indonesia - Watercolumn_Matano_2014_112_MGEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025017Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes)EnvironmentalOpen in IMG/M
3300025022Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes)EnvironmentalOpen in IMG/M
3300025135Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)EnvironmentalOpen in IMG/M
3300026057Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028176Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40mEnvironmentalOpen in IMG/M
3300028298Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40mEnvironmentalOpen in IMG/M
3300031552Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Draft_1001715693300001580Hydrocarbon Resource EnvironmentsMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVNEEHNRWSGFLCGREGQVLFDILSKETGKLDNSNLMLSWFTMASGRYEVLAYVA*
JGI20214J51088_1006315833300003432WetlandVDPTYFDEIPLADIMEAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKDTGKLDNSDLRLSWYTMASGRYEVLAYVA*
JGI20214J51088_1052615413300003432WetlandMKVAEKKKXNXAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
JGI20214J51650_1034017013300003541WetlandMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0055493_1007023623300004049Natural And Restored WetlandsMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0051987_1017042123300004088GroundwaterMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0066632_1006094213300004149GroundwaterMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSERYEVLAYVA*
Ga0066631_1026717023300004212GroundwaterAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0066635_1014399623300004238GroundwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIVGAIEGHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0069718_1632080123300004481SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0078972_121599913300005573Hot SpringMKVAEKRAVNRAIDKIVSPIYFNEIPLSPIFEAIENFGYLVVDEEHQPWSGFLCGREGTAMFDLFSKDKGKPDNSNLMLQWYTIQSGRYEVTCYVS*
Ga0100389_111305823300008001AquiferMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0100390_1036887913300008002AquiferMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMSSGRYEVLAYVA*
Ga0100394_115340013300008009AquiferMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHSSWSGFLCGREGQALFHILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA*
Ga0100377_113744323300009004AquiferMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMASGRYEVLAYVA*
Ga0105152_1031910013300009039Lake SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIREAIENHGYLVVDEEQNRWSGWLCGREGQAMFDILSRETGKLDNSSLRLSWYT
Ga0105152_1050536713300009039Lake SedimentMKVAEKKKVNKAIGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQALFDILSKKTGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0105099_1065780823300009082Freshwater SedimentKKVNKAVGVVVDPTFFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKQDNSNLRLSWYTMPSGRYEVLAYVA*
Ga0105099_1090287013300009082Freshwater SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGKSEVLAYVA
Ga0105107_1054705523300009087Freshwater SedimentMKVSEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0115026_1184269923300009111WetlandVVDPTYFNEIPLADIMEAIEDLGYLVVDEEHNRWSGFLCGREGQAMFNIFSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0105094_1062451213300009153Freshwater SedimentMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTIPSGRYEVLAYVA
Ga0105094_1066959623300009153Freshwater SedimentKVAEKKKVNKAVGVVVDPTYFSEIPLAGIMDAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0113563_1136418313300009167Freshwater WetlandsMKAAEKKKVNKAVGVVVDPTYFNEIPLADILEAIEGLGYLVVDEEHNRWSGFLCGREGQALFDILSNDTGRLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0105097_1039714723300009169Freshwater SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEVIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0123519_1019811413300009503Hot SpringMKVAEKRAVNRAIDKIVSPIYFNEIPLSPIFEAIESFGYLVVDEEHQPWSGFLCGREGTAMFDLFSKEKGKPDNSNLMLQWYTIQSGRYEVTCYVS*
Ga0114946_1003316723300009504SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSNLMLSWYTMASGRYEVLAYVA*
Ga0114946_1004300233300009504SedimentMKVAEKKKVNRDVGVVVDPTYFSEIPLADIMDAIESHGYLVVDEEHTRWSGWLCGREGQALFNILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA*
Ga0114946_1032813023300009504SedimentMKQKNLWRWSLKVSEKRKVNKAVGVVMDPTYFNEIPLADIMGAIEGLGYLVVDDEHNRWSGWLCGREGQAMFDILSTETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0114946_1066687613300009504SedimentKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWAGFLCGREGQALFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA*
Ga0136653_1005313513300010319Anoxic Lake WaterMKVAGKKKVNKAVGVVVAPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0163200_103649213300013088FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0163209_128816823300013090FreshwaterMKVAEKKKVNKAVGVVVVPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0163199_120941913300013092FreshwaterVRQKTFGGGLKVAEKKKVNKAVGIVVDPPYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAIFDILSKETGKLDNSNLRLSWYTMASGRYEVLA
Ga0163199_126880323300013092FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIEGHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0163199_131570523300013092FreshwaterMKVAEKKKVNKSVGVVVDPTYFSEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRYEVLAYVA*
Ga0163199_136780223300013092FreshwaterMKVAEKKKVNKSVGVVVDPTYFSEIPLAGIMDAIESHGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA*
(restricted) Ga0172374_109853313300013122FreshwaterQNKSWRWAMKVAEKRKVNKAVGVVVDPTYFNEIPLAGIMDAIEGFGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
(restricted) Ga0172368_1024653613300013123FreshwaterMKVAEKKKVNKAVGVVVVPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA*
(restricted) Ga0172368_1042295013300013123FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLAGIMDAIEGFGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVL
(restricted) Ga0172369_1010815223300013125FreshwaterMKVAEKRKVNKAVGVVVDPTYFNEIPLAGIMDAIEGFGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
(restricted) Ga0172373_1024799323300013131FreshwaterMKVAEKKKVNKAVGAVVDPTYFNEIPLVDIMEAIEGFGYLVVDEEHNRWSGFLCGREGQVLFDILSKETGKLDNSNLMLSWFTMASGRYEVLAYVA*
(restricted) Ga0172370_1035708023300013136FreshwaterMKVAEKKKVNKAVGVVVAPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA*
(restricted) Ga0172375_1002491923300013137FreshwaterMKVAEKKKVNKAVGVVVAPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
(restricted) Ga0172375_1004245963300013137FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEALGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA*
(restricted) Ga0172375_1027666223300013137FreshwaterMKVAEKKRVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA*
(restricted) Ga0172375_1052565913300013137FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHSRWSGFLCGREGQAMFDIISRETGKLDNSNLMLSWYTMASGRYEVLAYVA*
(restricted) Ga0172375_1068854823300013137FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEECNRWSGFLCGGEGQALFDILSKETGKLDNSNLRLSWYTMPSGRYEVLAYVA*
(restricted) Ga0172375_1072373323300013137FreshwaterMKVAEKKKVNKAVGVVVAPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0180014_101802033300013391GroundwaterGETKNLWRWSMKVAEKKKVNKAVGVVVDPTYFSEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA*
Ga0075339_120962313300014316Natural And Restored WetlandsMKVAEKKKVNKAVGVVVAPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0075348_108434713300014319Natural And Restored WetlandsMKVAEKKKVNKAVGVVVDPTYFNEIPLAEIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA*
Ga0182021_1106803323300014502FenMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLMLSWYTMASGRYEVLAYVA*
Ga0182021_1148283213300014502FenMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSW
Ga0184616_1012400623300018055Groundwater SedimentMKVAEKKKINKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQALFHILSRETGELDNSNLRLSWYTMASGRHEVLAYVA
Ga0184631_1009562323300018070Groundwater SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0212124_1016474923300022553FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0212124_1024889723300022553FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLTDIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRYEVLAYVA
Ga0212124_1025475423300022553FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIEGHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0212121_1031153123300022556Anoxic Lake WaterMKVAGKKKVNKAVGVVVAPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLMLSWYTMPSGRYEVLAYVA
(restricted) Ga0233423_10000595183300023177FreshwaterMKVVEKKKINKAVGVVVDPTYFNEIPLAAIMDAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMPSGRYEVLAYVA
Ga0256681_1180403423300023311FreshwaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA
Ga0210022_105242813300025017AquiferMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA
Ga0210056_110376523300025022GroundwaterMKVAEKKKINTAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSERYEVLAYVA
Ga0209498_103906313300025135SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWAGFLCGREGQALFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0209498_114511513300025135SedimentMKVAEKKKVNRDVGVVVDPTYFSEIPLADIMDAIESHGYLVVDEEHTRWSGWLCGREGQALFNILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0209498_123374813300025135SedimentLWRWSLKVSEKRKVNKAVGVVMDPTYFNEIPLADIMGAIEGLGYLVVDDEHNRWSGWLCGREGQAMFDILSTETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0208294_102862913300026057Natural And Restored WetlandsVDPTYFDEIPLADIMEAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSKDTGKLDNSDLRLSWYTMASGRYEVLAYVA
Ga0209703_117671523300027723Freshwater SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFNILSKETGKQDNSNLMLSWYTMPSGRYEVLAYVA
Ga0207433_1017824813300027863Hot SpringMKVAEKRAVNRAIDKIVSPIYFNEIPLSPIFEAIENFGYLVVDEEHQPWSGFLCGREGTAMFDLFSKDKGKPDNSNLMLQWYTIQSGRYEVTCYVS
Ga0209254_1049864113300027897Freshwater Lake SedimentMKVGEKKKVNKTVGVVMDPTYFNEIPLVDIMEAIEGLGFLVVDEEHNRWSGFLCGREGQTMFDILSKETGKLDNSNLMLSWYTMASGGTRFWLMWPETLNRG
Ga0209254_1068389523300027897Freshwater Lake SedimentMKVAEKKKVNKSVGVVVDPTYFSEIPLAGIMDAIENHGYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA
Ga0209254_1095248423300027897Freshwater Lake SedimentLTKNNLWRWIIKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMPSGRYEVLAYVA
Ga0209048_1015835313300027902Freshwater Lake SedimentMKAAEKKKVNKAVVVVVDPIYFNEIPLPNIMEAIEGLGYLVVNEEHNRWSGFLCGREGQAMFDILSKETGKLDHSNLRLSWHTIPSGRYEVLAYVA
Ga0268284_108065813300028176Saline WaterMKVAEKKKVNKAVGVVVDPTYFSEIPLADIMGAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0268280_104285213300028298Saline WaterMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVADEEHNRWSGFLCRSQGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315542_100005523300031552Salt Marsh SedimentMKAAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGSQGQAMFNILSKETGKLDNSNLMLSWYTMASGRYEVLAYVA
Ga0315542_130727723300031552Salt Marsh SedimentEKKKVNKAVGVVVDPTYFNEIPLADIMGAIEGHGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315293_1062225323300031746SedimentRWAMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315290_1017724923300031834SedimentMKVAEKKNVNKAVRVVMDPTYFNEIPLADIMGAIEGFNYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315290_1094949013300031834SedimentMKAAEKKKVNKAVGVVVDPTYFNKIPLADIMEVIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASG
Ga0315290_1110579013300031834SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSKETGKLDNSNLRLSWYTMAS
Ga0315290_1153340213300031834SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEECNRWSGWLCGREGQAMFDILSKETGKLDSSNLRLSWYTMASGRYEVLAYVA
Ga0315297_1039628823300031873SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRYEVLAYVA
Ga0315297_1058881813300031873SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSNLRLSWYTMPSGRYEVLAYVA
Ga0315297_1100265023300031873SedimentMKVAEKKKVNKSVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315297_1135605013300031873SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEECNRWSGWLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315297_1160793213300031873SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIMEAIENHGYLVVDEEQNRWSGWLCGREGQAMFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315294_1146760323300031952SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSRETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315278_1101752413300031997SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGSQGQALFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315278_1137822223300031997SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYAMPSGRYEVLAYVA
Ga0315278_1182559413300031997SedimentMKVSQKKKVNKAVGVVVDPTYFNEIPLADIMGAIEGFNYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315274_1086934513300031999SedimentMKVAEKKKVNKAVGVVMDPTYFNEIPLADIMKAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315292_1163521713300032143SedimentMKVAEKKKVNKAVGVVVDPTYFSEIPLADIMGAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLRLSWYTMAS
Ga0315295_1116647713300032156SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIMDAIESHGYLVVDEEHTRWSGWLCGREGQALFNILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315281_1196239113300032163SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIMEAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGNLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315283_1068043613300032164SedimentMKVSEKKKVNKAVGVVVDPTYFNEIPLADIMGAIEGFNYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315283_1113603013300032164SedimentMKVAEKKKVNKAVGVVVDPTYFSEIPLADIMEAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315268_1005174023300032173SedimentMKVAEKKKVNKAVGIVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315268_1056934123300032173SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWAGFLCGREGQAMFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315276_1020188523300032177SedimentMKVAEKKKVNKTVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGSQGQALFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315276_1055044123300032177SedimentMKAAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWAGFLCGREGQALFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315276_1099134613300032177SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNSWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315276_1152706013300032177SedimentMKVAEKKKVNKSVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315276_1212300723300032177SedimentMKVAEKKKVNKAVGVVVDPTYFSEIPLAGIMDAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315270_1014621723300032275SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315286_1070993023300032342SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIENHGYLLVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRYEVLAYVA
Ga0315286_1099293323300032342SedimentMKVAEKKKVNKAVGVVVDPTYFSEIPLAGIMDAIENHGYLVVDEEHNRWSGWVCGREGQALFNILSKETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315286_1115948933300032342SedimentAMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYAMPSGRYEVLAYVA
Ga0315287_1054849423300032397SedimentMKVAEKKNVNKAVRVVMDPTYFNEIPLADIMGAIEGLGYLVVDEEHNRWFGFLCGREGQAMFDIISKETGKLDNSNLRLSWYTMASGRYEVLAYVA
Ga0315287_1113043313300032397SedimentNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYAMPSGRYEVLAYVA
Ga0315287_1184404213300032397SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMGAIENHGYLVVDEEHNRWSGWLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRY
Ga0315275_1221741413300032401SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWAGFLCGREGQALFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315273_1038111433300032516SedimentMKVSEKKKVNKAVGVVVDPTYFNEIPLADIMGAIEGFNYLVVDEEHNRWSGFLCGREGQALFDILSKETGKLDNSNLRLSWYTMASGRYEVLA
Ga0315273_1116563023300032516SedimentMKVAEKKKVNRDVGVVVDPTYFNEIPLADIMEAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYVA
Ga0315273_1156865513300032516SedimentHKAEAPFSSNLNGGKTMKVAEKKKVNKAVGVVVDPTYFNEIPLPDIINAIENHGYLVVDEEHNRWSGFLCGREGQAMFDILSRETGKLDNSSLMLSWYTMASGRYEVLAYVA
Ga0315273_1167504913300032516SedimentMKVAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGFGYLVVDEEHNSWSGFLCGREGQAMFDILSKETGKLDNSNLRLSWYT
Ga0315273_1190232613300032516SedimentMKAAEKKKVNKAVGVVVDPTYFNEIPLADIMEAIEGLGYLVVDEEHNRWAGFLCGREGQALFDILSRETGKLDNSSLRLSWYTMASGRYEVLAYV
Ga0315273_1254880713300032516SedimentMKVAEKKKVNKTVGVVVDPTYFNEIPLADIMDAIENHGYLVVDEEHNRWSGFLCGSQGQALFDILSQETGKLDNSNLRLSWYTMASGRYEVLAYVS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.