Basic Information | |
---|---|
Family ID | F074086 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 38 residues |
Representative Sequence | TIAFLLWARFVLLVACGALVALYLWIGYRSHRAG |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 55.83 % |
% of genes near scaffold ends (potentially truncated) | 25.00 % |
% of genes from short scaffolds (< 2000 bps) | 78.33 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.833 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF13672 | PP2C_2 | 34.17 |
PF00498 | FHA | 26.67 |
PF14450 | FtsA | 8.33 |
PF00481 | PP2C | 6.67 |
PF00069 | Pkinase | 3.33 |
PF00486 | Trans_reg_C | 2.50 |
PF12704 | MacB_PCD | 1.67 |
PF13620 | CarboxypepD_reg | 0.83 |
PF06966 | DUF1295 | 0.83 |
PF01098 | FTSW_RODA_SPOVE | 0.83 |
PF08281 | Sigma70_r4_2 | 0.83 |
PF06723 | MreB_Mbl | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 13.33 |
COG0631 | Serine/threonine protein phosphatase PrpC | Signal transduction mechanisms [T] | 6.67 |
COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
COG2020 | Protein-S-isoprenylcysteine O-methyltransferase Ste14 | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG3752 | Steroid 5-alpha reductase family enzyme | General function prediction only [R] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.83 % |
Unclassified | root | N/A | 4.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105603379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300001686|C688J18823_10099229 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
3300001686|C688J18823_10205538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1326 | Open in IMG/M |
3300001686|C688J18823_10740861 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300004114|Ga0062593_100005014 | All Organisms → cellular organisms → Bacteria | 5420 | Open in IMG/M |
3300005293|Ga0065715_10021688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1387 | Open in IMG/M |
3300005333|Ga0070677_10698999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300005406|Ga0070703_10414835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300005534|Ga0070735_10233622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
3300005537|Ga0070730_10966536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300005540|Ga0066697_10010943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4676 | Open in IMG/M |
3300005543|Ga0070672_100016731 | All Organisms → cellular organisms → Bacteria | 5258 | Open in IMG/M |
3300005548|Ga0070665_100030157 | All Organisms → cellular organisms → Bacteria | 5458 | Open in IMG/M |
3300005548|Ga0070665_100121778 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
3300005549|Ga0070704_100365645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
3300005552|Ga0066701_10086005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
3300005578|Ga0068854_100018811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4644 | Open in IMG/M |
3300005578|Ga0068854_100622191 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300005713|Ga0066905_100049355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2563 | Open in IMG/M |
3300005719|Ga0068861_100018096 | All Organisms → cellular organisms → Bacteria | 5012 | Open in IMG/M |
3300005719|Ga0068861_100778601 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005764|Ga0066903_100011461 | All Organisms → cellular organisms → Bacteria | 8587 | Open in IMG/M |
3300005764|Ga0066903_100058511 | All Organisms → cellular organisms → Bacteria | 4788 | Open in IMG/M |
3300005764|Ga0066903_100148292 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
3300005764|Ga0066903_100535556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2001 | Open in IMG/M |
3300005764|Ga0066903_101297611 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300005764|Ga0066903_101460357 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300005764|Ga0066903_104525914 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005764|Ga0066903_106566366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300005764|Ga0066903_107480076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300005841|Ga0068863_100078800 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
3300005841|Ga0068863_100188908 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
3300005841|Ga0068863_101576835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300005841|Ga0068863_102644185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300005843|Ga0068860_100263563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1680 | Open in IMG/M |
3300005843|Ga0068860_101241788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300005937|Ga0081455_10238859 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300006028|Ga0070717_11569149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300006038|Ga0075365_10152134 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300006051|Ga0075364_10144400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
3300006051|Ga0075364_11134232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300006163|Ga0070715_10379682 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300006163|Ga0070715_10564171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300006173|Ga0070716_101245660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300006237|Ga0097621_100072396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2850 | Open in IMG/M |
3300006358|Ga0068871_100048492 | All Organisms → cellular organisms → Bacteria | 3429 | Open in IMG/M |
3300006578|Ga0074059_12124475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300006581|Ga0074048_13227357 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300006796|Ga0066665_10934542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300006854|Ga0075425_100000887 | All Organisms → cellular organisms → Bacteria | 28716 | Open in IMG/M |
3300006854|Ga0075425_100353987 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1690 | Open in IMG/M |
3300006871|Ga0075434_102404300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300006881|Ga0068865_100245535 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300009093|Ga0105240_11089731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
3300009098|Ga0105245_11072712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
3300009156|Ga0111538_11353625 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300009177|Ga0105248_10068668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3979 | Open in IMG/M |
3300010047|Ga0126382_10485813 | Not Available | 989 | Open in IMG/M |
3300010359|Ga0126376_11143960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300010359|Ga0126376_12987933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300010362|Ga0126377_10725278 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300010366|Ga0126379_10012158 | All Organisms → cellular organisms → Bacteria | 6111 | Open in IMG/M |
3300010366|Ga0126379_10625033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300010366|Ga0126379_12204998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300010366|Ga0126379_12432493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300010396|Ga0134126_10877958 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300010397|Ga0134124_11401393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300010398|Ga0126383_12206108 | Not Available | 637 | Open in IMG/M |
3300010400|Ga0134122_10388128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
3300012212|Ga0150985_103171277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300012212|Ga0150985_108086959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1532 | Open in IMG/M |
3300012212|Ga0150985_110237303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300012212|Ga0150985_110340604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300012469|Ga0150984_100177432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300012469|Ga0150984_108949592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 972 | Open in IMG/M |
3300012469|Ga0150984_119800510 | Not Available | 682 | Open in IMG/M |
3300012489|Ga0157349_1018002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300012685|Ga0137397_11034326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300012948|Ga0126375_10620187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300012957|Ga0164303_11352542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300012971|Ga0126369_10432129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1362 | Open in IMG/M |
3300012984|Ga0164309_11731435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300012985|Ga0164308_11009534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300012986|Ga0164304_11219236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300012989|Ga0164305_10925348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300013296|Ga0157374_10021748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5712 | Open in IMG/M |
3300013308|Ga0157375_12967695 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300015086|Ga0167655_1034111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300015201|Ga0173478_10271345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300015371|Ga0132258_11050653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
3300015373|Ga0132257_101059089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
3300016357|Ga0182032_10387293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
3300016404|Ga0182037_10748514 | Not Available | 839 | Open in IMG/M |
3300022898|Ga0247745_1018456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
3300025315|Ga0207697_10397353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300025907|Ga0207645_10004277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 10600 | Open in IMG/M |
3300025913|Ga0207695_10982811 | Not Available | 724 | Open in IMG/M |
3300025918|Ga0207662_10012816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4677 | Open in IMG/M |
3300025931|Ga0207644_10274425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
3300025935|Ga0207709_10241686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
3300025940|Ga0207691_10028053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5274 | Open in IMG/M |
3300025960|Ga0207651_12054897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300027866|Ga0209813_10011514 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
3300028381|Ga0268264_12649846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300031226|Ga0307497_10329398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300031545|Ga0318541_10144602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
3300031640|Ga0318555_10722506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300031668|Ga0318542_10665061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300031719|Ga0306917_10429434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300031846|Ga0318512_10525814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300031847|Ga0310907_10635693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300031854|Ga0310904_10426064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300031912|Ga0306921_11135392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 874 | Open in IMG/M |
3300032012|Ga0310902_11024258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300032013|Ga0310906_11345994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300032075|Ga0310890_10596909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
3300032076|Ga0306924_10396535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1580 | Open in IMG/M |
3300032180|Ga0307471_101961053 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300032205|Ga0307472_100884324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300032261|Ga0306920_100347494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2207 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.33% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.50% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.83% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.83% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.83% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1056033792 | 3300000364 | Soil | MIAFLLRARVFFLPACGALVSLYLWIGYRSQKAE* |
C688J18823_100992293 | 3300001686 | Soil | MIALLWWTRVLFFVACGALVSLYLWIGYRSRNAE* |
C688J18823_102055382 | 3300001686 | Soil | MMAFLLSARLLFLLACGALVSLYVWIGWRSRTAK* |
C688J18823_107408612 | 3300001686 | Soil | MEHTIVFLLWARFALLAACGALVALYLWIGYRSHRAG* |
Ga0062593_1000050142 | 3300004114 | Soil | MEDRMADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0065715_100216882 | 3300005293 | Miscanthus Rhizosphere | MEDRMADNIVFLLWARFVLLVVCGALVALYLWIGYRSHRAG* |
Ga0070677_106989992 | 3300005333 | Miscanthus Rhizosphere | RTRGRTAAHVVQGVLVMDHRIALLLWGRFVFLAACGALVALYLWIGYRSHRAG* |
Ga0070703_104148352 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYVAQGVGLMEDRMADNIVFLLWARFVLLVVCGALVALYLWIGYRSHRAG* |
Ga0070735_102336222 | 3300005534 | Surface Soil | MEHPIAFLLWARFVLLVACGAVVALYLWIGYRSHR |
Ga0070730_109665362 | 3300005537 | Surface Soil | MEHPIAFLLWARFVLLVACGAVVALYLWIGYRSHRAG* |
Ga0066697_100109432 | 3300005540 | Soil | MIALLLSVRLLFLMACGVLVALYLWIGYRSRKAE* |
Ga0070672_1000167314 | 3300005543 | Miscanthus Rhizosphere | MEDRMADTIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0070665_1000301576 | 3300005548 | Switchgrass Rhizosphere | MIAFLLSARFFFLLACGALVSLYLWIGYRSNTAE* |
Ga0070665_1001217782 | 3300005548 | Switchgrass Rhizosphere | MIASLLQARFFFLLACGVLVSLYLWIGYRSHRAE* |
Ga0070704_1003656452 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QGVGLMEDRMADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0066701_100860052 | 3300005552 | Soil | MIALLLWVRLLFLMACGVLVALYLWIGYRSRKAE* |
Ga0068854_1000188112 | 3300005578 | Corn Rhizosphere | MIAFLWWARVLLFVACGALVSLYLWIGYRSRRAE* |
Ga0068854_1006221912 | 3300005578 | Corn Rhizosphere | MIALLLWGRLLFFVACGALVSLYVWIGYCSRRSE* |
Ga0066905_1000493552 | 3300005713 | Tropical Forest Soil | MMAFLLWARFLFLGACGALVSLYLWIGWRSHGAK* |
Ga0068861_1000180964 | 3300005719 | Switchgrass Rhizosphere | MEDRMADNIVFLLWARFLLLVACGALVALYLWIGYRSHRAG* |
Ga0068861_1007786012 | 3300005719 | Switchgrass Rhizosphere | MMAFLLWARFLFLLACGALVSLYVWIGWRSHAAK* |
Ga0066903_1000114616 | 3300005764 | Tropical Forest Soil | MIAFLLWARFLLFVACGVLISLYLVIGWRSDTAK* |
Ga0066903_1000585114 | 3300005764 | Tropical Forest Soil | MEDRMADIAFLLWARFVFLVACGALVALYLWMGYRSHRAG* |
Ga0066903_1001482925 | 3300005764 | Tropical Forest Soil | MTTFLLWARLPFLVACGILVALYLWIGYLSSRAG* |
Ga0066903_1005355562 | 3300005764 | Tropical Forest Soil | MIAFLLWARFVFLLACGALVWLYLWVSDQSDRNQ* |
Ga0066903_1012976112 | 3300005764 | Tropical Forest Soil | MEDKIAFLLWARFVLLIACGALVALYLWIGYRSHRAGGAS* |
Ga0066903_1014603572 | 3300005764 | Tropical Forest Soil | MIAFLLWARFVFLAACGALVSLYLWIGCRSHRAE* |
Ga0066903_1045259142 | 3300005764 | Tropical Forest Soil | MIAFLLWARFGFLLACGALVWLYLSMSYPSDREP* |
Ga0066903_1065663662 | 3300005764 | Tropical Forest Soil | MIALLLKARFVFLAASGALVSLYLWIGYRSHRAE* |
Ga0066903_1074800761 | 3300005764 | Tropical Forest Soil | TPMIAFLLWARFVFLFACGALVWLYLWMSYQSDRKQ* |
Ga0068863_1000788001 | 3300005841 | Switchgrass Rhizosphere | MIAFLLVARFYFLLACGVLVSLYLWIGYRSHRAE* |
Ga0068863_1001889083 | 3300005841 | Switchgrass Rhizosphere | EGVGLMEDRMADTIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0068863_1015768352 | 3300005841 | Switchgrass Rhizosphere | MIVFLLRAHVFFLVACGVLVSLYLWIGYRSHKAE* |
Ga0068863_1026441852 | 3300005841 | Switchgrass Rhizosphere | MMAFLLWARFGFLLACGALLSFYLWIGYRSHTAE* |
Ga0068860_1002635633 | 3300005843 | Switchgrass Rhizosphere | MMTFLLWARFLFLLACGALVSLYVWIGWRSHAAK* |
Ga0068860_1012417882 | 3300005843 | Switchgrass Rhizosphere | MIAFLLQARFFFLLACGALVSLYLWIGYRSHRAE* |
Ga0081455_102388592 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MEHRIAWLLWGRFVLLAACGALVALYLWIGYRSHRAG* |
Ga0070717_115691491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RTRGRAAAHVVQGVLLMEHTIAFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0075365_101521342 | 3300006038 | Populus Endosphere | MEDRMADNIVFLLWARFVLLAACGALVALYLWIGYRSHRAG* |
Ga0075364_101444002 | 3300006051 | Populus Endosphere | MIAFLLWARFLLLAACGALISLYLWVGWRSRMAK* |
Ga0075364_111342321 | 3300006051 | Populus Endosphere | MEDRMADNIVFLLWARFALLGACGALVALYLWIGYRSHRAG* |
Ga0070715_103796822 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATLLWARFLFLLACGALVSLYLWIGWRSHGAK* |
Ga0070715_105641712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIALLWWTRVLFFAACGALVSLYFWIGYRSRNAE* |
Ga0070716_1012456601 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PRVPKAMIAVLLWARFVLLLACGALVSLYLWIGYRSHTAE* |
Ga0097621_1000723962 | 3300006237 | Miscanthus Rhizosphere | MIAFLLSARYFFLLACGVLIFLYLWIGYRSHTAE* |
Ga0068871_1000484922 | 3300006358 | Miscanthus Rhizosphere | MIAFLLSARYFFLLACGVLISLYLWIGYRSHTAE* |
Ga0074059_121244751 | 3300006578 | Soil | PRFPKAMIAFLLLARFYFLLACGVLVSLYLWIGYRSHRAE* |
Ga0074048_132273572 | 3300006581 | Soil | MIAFLLRAHFFFLLACGVLVSLYLWIGYRSHKAE* |
Ga0066665_109345421 | 3300006796 | Soil | MIAFLLWARFLFLLACGALVSLYLWIGYRSHTAE* |
Ga0075425_1000008879 | 3300006854 | Populus Rhizosphere | MIALLWWARVLFFVACGALVSLYLWIGYRSRSAE* |
Ga0075425_1003539872 | 3300006854 | Populus Rhizosphere | MIALLLWARFLFLMACGTLVVLYLWIGYRSRKAE* |
Ga0075434_1024043002 | 3300006871 | Populus Rhizosphere | MIALLLWARFIFLMACGTLVVLYLWIGYRSRKAE* |
Ga0068865_1002455352 | 3300006881 | Miscanthus Rhizosphere | MADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0105240_110897311 | 3300009093 | Corn Rhizosphere | SAVAAAIMIALLLWGRLLFFVACGALVSLYVWIGYCSRRSE* |
Ga0105245_110727121 | 3300009098 | Miscanthus Rhizosphere | MIAFLLSARFFFLLACGALVSLYLWIGYRSHTAE* |
Ga0111538_113536252 | 3300009156 | Populus Rhizosphere | MEDRVADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0105248_100686682 | 3300009177 | Switchgrass Rhizosphere | MIVFLLRAHVFFLVACGVLVSLYLWIGYRSHQAE* |
Ga0126382_104858132 | 3300010047 | Tropical Forest Soil | MDRIALLLWARFVLLAACGALVALYLWIGYRSHRAG* |
Ga0126376_111439602 | 3300010359 | Tropical Forest Soil | MIAFLLRARFFLLLACGALVSLYLWIGYRSHTAE* |
Ga0126376_129879332 | 3300010359 | Tropical Forest Soil | MIAFLLWARFFFLLACGALVSLYLWIGYKSRTAE* |
Ga0126377_107252782 | 3300010362 | Tropical Forest Soil | MEDRIALLLWARFVLLAAWGALVALYLWIGYRSHRAG* |
Ga0126379_100121584 | 3300010366 | Tropical Forest Soil | MIAYLLWARFGFLVACGALVVLYLWIGYRSHRAG* |
Ga0126379_106250331 | 3300010366 | Tropical Forest Soil | MEDTIGFLLWARFVLLIACGVLVALYLWIGYRSHRAGGAS* |
Ga0126379_122049982 | 3300010366 | Tropical Forest Soil | MIAFLQWARILFLVACGALVSLYVWIGYRSRKAE* |
Ga0126379_124324932 | 3300010366 | Tropical Forest Soil | MVDRIAFLLWARFVLLAACGALVALYLWMGYRSHRAE* |
Ga0134126_108779582 | 3300010396 | Terrestrial Soil | MEDRMADNIVLLLWARFVLLVVCGALVALYLWIGYRSHRAG* |
Ga0134124_114013932 | 3300010397 | Terrestrial Soil | MIASLLQARFFFLLACGVLVSLYLWIGYRSNTAE* |
Ga0126383_122061082 | 3300010398 | Tropical Forest Soil | MEPHTIAFLLRARFVLLAACGALVALYLWIGYRSYRAG* |
Ga0134122_103881282 | 3300010400 | Terrestrial Soil | MIAFLLSARFFFLLACGVLISLYLWIGYRSHTAE* |
Ga0150985_1031712772 | 3300012212 | Avena Fatua Rhizosphere | MEHPIAFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0150985_1080869592 | 3300012212 | Avena Fatua Rhizosphere | MMAFLLSARLLFLLACGALVSLYVWIGWRSHTAK* |
Ga0150985_1102373032 | 3300012212 | Avena Fatua Rhizosphere | MIAFLLQARFGFLLACGALVLFYLWIGYRSHSAE* |
Ga0150985_1103406042 | 3300012212 | Avena Fatua Rhizosphere | MIAFLLWPRVVFFVACGALVLLYLWIGYRSCTTERTTRCR |
Ga0150984_1001774322 | 3300012469 | Avena Fatua Rhizosphere | MEHTIVLLLWGRFVLLAACGALVALYLWIGYRSHRAG* |
Ga0150984_1089495922 | 3300012469 | Avena Fatua Rhizosphere | MMAFLLSARFGFLLACGALVLFYLWIGYRSHSAE* |
Ga0150984_1198005101 | 3300012469 | Avena Fatua Rhizosphere | MDHTSVLLLWGRLVLLVACGALVALYLWIGYRSHRAG* |
Ga0157349_10180022 | 3300012489 | Unplanted Soil | MEDRMADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAA* |
Ga0137397_110343262 | 3300012685 | Vadose Zone Soil | MMAFLLWARFLFLLACGALVSLYLWIGYRSHTAE* |
Ga0126375_106201872 | 3300012948 | Tropical Forest Soil | MIAFLLWARFFFLLACAALVWLYLWMSYQSDRKP* |
Ga0164303_113525422 | 3300012957 | Soil | MIAFLLRARLFFLVGCGALAALYLWIANRSHSAE* |
Ga0126369_104321292 | 3300012971 | Tropical Forest Soil | MIAFLLWARVLFFVACGGLVSLYVWIGYRSRGAE* |
Ga0164309_117314352 | 3300012984 | Soil | MIAFLLWARFFLLLACGALVSLYLWIGYRSHKAE* |
Ga0164308_110095341 | 3300012985 | Soil | PKAMIAFLLWARFVFLLACGALVALYLWIGYRSHRTE* |
Ga0164304_112192361 | 3300012986 | Soil | TIAFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0164305_109253482 | 3300012989 | Soil | MIAFLLWARFLFLLACGALVSLYLWIGYRSHKAE* |
Ga0157374_100217482 | 3300013296 | Miscanthus Rhizosphere | MIAFLWWARVLFFVACGALVSLYLWIGYRSHRAE* |
Ga0157375_129676952 | 3300013308 | Miscanthus Rhizosphere | MIAFLLRARFLFLPACAALVSLYLWIGYRSHRAE* |
Ga0167655_10341112 | 3300015086 | Glacier Forefield Soil | MIALLLSARFFFLLACGALVSLYLWIGYRSDTAE* |
Ga0173478_102713452 | 3300015201 | Soil | MEDRMADNIMFLLWARFVLLVACGALVALYLWIGYRSHRAG* |
Ga0132258_110506533 | 3300015371 | Arabidopsis Rhizosphere | MMTFLLEARYLFLLACGALVSLYLWIGCRSNAAK* |
Ga0132257_1010590891 | 3300015373 | Arabidopsis Rhizosphere | AMIAFLLQARFFFLLACGALVSLYLWIGYRSHRAE* |
Ga0182032_103872932 | 3300016357 | Soil | MPHEIAFLLRARFVLLVACGALVALYLWIGYRSHRAGEQ |
Ga0182037_107485142 | 3300016404 | Soil | MDPHKIAFLLEARFVLLAACGALVALYLWIGYRSHRAG |
Ga0247745_10184562 | 3300022898 | Soil | MEDRMADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG |
Ga0207697_103973532 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDRMADNIVFLLWARFVLLVVCGALVALYLWIGYRSHRAG |
Ga0207645_100042772 | 3300025907 | Miscanthus Rhizosphere | MEDRMADNIVFLLWARFLLLVACGALVALYLWIGYRSHRAG |
Ga0207695_109828111 | 3300025913 | Corn Rhizosphere | MEDRMADNIVFLLWARFVLLVVCGALVALYLWIGYRSH |
Ga0207662_100128161 | 3300025918 | Switchgrass Rhizosphere | MEDRMADNIVFLLWARFVLLVACGALVALYLWIGYR |
Ga0207644_102744251 | 3300025931 | Switchgrass Rhizosphere | SAAAMIAFLWWARVLLFVACGALVSLYLWIGYRSRRAE |
Ga0207709_102416862 | 3300025935 | Miscanthus Rhizosphere | AAHVVEGVGLMEDRMADNIVFLLWARFLLLVACGALVALYLWIGYRSHRAG |
Ga0207691_100280533 | 3300025940 | Miscanthus Rhizosphere | MEDRMADTIVFLLWARFVLLVACGALVALYLWIGYRSHRAG |
Ga0207651_120548971 | 3300025960 | Switchgrass Rhizosphere | AAMIAFLWWARVLWFVACGALVSLYLWIGYRSRRAE |
Ga0209813_100115143 | 3300027866 | Populus Endosphere | QGVGLMEDRMADNIVFLLWARFVLLAACGALVALYLWIGYRSHRAG |
Ga0268264_126498461 | 3300028381 | Switchgrass Rhizosphere | FPKAAMMTFLLWARFLFLLACGALVSLYVWIGWRSHAAK |
Ga0307497_103293981 | 3300031226 | Soil | AMTAFLLRAHVFFLLACGVLVSLYLWIGYRSHRAE |
Ga0318541_101446021 | 3300031545 | Soil | PRLPKAMIAILLWARLFFLFACGALVLLYLWIGYRSHRAE |
Ga0318555_107225062 | 3300031640 | Soil | MEPHTIAFLLWARFVLLAACGALVALYLWIGYRSHRAG |
Ga0318542_106650612 | 3300031668 | Soil | VIAFLLWARFVFLAACGALVALYLWIGYRSHRAGGST |
Ga0306917_104294341 | 3300031719 | Soil | VIAFLLWARFVFLAACGALVALYLWIGYRSHRAGEQ |
Ga0318512_105258141 | 3300031846 | Soil | LPRFPKAPMIAVLLRARFVFLIASGALVLLYLWIGYRSNRAE |
Ga0310907_106356932 | 3300031847 | Soil | MDHRIALLLWGRFVFLAACGALVALYLWIGYRSHRAG |
Ga0310904_104260642 | 3300031854 | Soil | MEDRMADNIVFLLWARFALLGACGALVALYLWIGYRSHRAG |
Ga0306921_111353922 | 3300031912 | Soil | MEPHKIAVLLWARFVLLVACGALVALYLWIGYRSHRAG |
Ga0310902_110242582 | 3300032012 | Soil | QGVGLMEDRMADNIVFLLWARFVLLVACGALVALYLWIGYRSHRAG |
Ga0310906_113459942 | 3300032013 | Soil | MEDRMADNIVFLLWARCVLLVACGALVALYLWIGYRSHRAG |
Ga0310890_105969092 | 3300032075 | Soil | GRTAAHVVEGVGLMEDRMADTIVFLLWARFVLLVACGALVALYLWIGYRSHRAG |
Ga0306924_103965352 | 3300032076 | Soil | PKAMIAILLWARLFFLFACGALVLLYLWIGYRSHRAE |
Ga0307471_1019610532 | 3300032180 | Hardwood Forest Soil | MEDRMADNIVFLLWARFVLLAACGALVALYLWIGYRSHRAG |
Ga0307472_1008843241 | 3300032205 | Hardwood Forest Soil | KEMIALLLQARFFFLLACGALVSLYLWIGYRSHRAE |
Ga0306920_1003474943 | 3300032261 | Soil | VIAFLLWARFVFLAACGALVALYLWIGYRSHRAGGVT |
⦗Top⦘ |