Basic Information | |
---|---|
Family ID | F073900 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 38 residues |
Representative Sequence | MQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 19.17 % |
% of genes near scaffold ends (potentially truncated) | 65.00 % |
% of genes from short scaffolds (< 2000 bps) | 85.83 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.167 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF00589 | Phage_integrase | 5.00 |
PF12728 | HTH_17 | 4.17 |
PF11154 | DUF2934 | 2.50 |
PF13185 | GAF_2 | 2.50 |
PF11848 | DUF3368 | 2.50 |
PF13561 | adh_short_C2 | 1.67 |
PF13602 | ADH_zinc_N_2 | 1.67 |
PF07080 | DUF1348 | 1.67 |
PF14685 | Tricorn_PDZ | 0.83 |
PF02502 | LacAB_rpiB | 0.83 |
PF00106 | adh_short | 0.83 |
PF13470 | PIN_3 | 0.83 |
PF12831 | FAD_oxidored | 0.83 |
PF03479 | PCC | 0.83 |
PF01436 | NHL | 0.83 |
PF01668 | SmpB | 0.83 |
PF05016 | ParE_toxin | 0.83 |
PF13489 | Methyltransf_23 | 0.83 |
PF08281 | Sigma70_r4_2 | 0.83 |
PF13482 | RNase_H_2 | 0.83 |
PF07228 | SpoIIE | 0.83 |
PF01641 | SelR | 0.83 |
PF13768 | VWA_3 | 0.83 |
PF04454 | Linocin_M18 | 0.83 |
PF00588 | SpoU_methylase | 0.83 |
PF02371 | Transposase_20 | 0.83 |
PF00230 | MIP | 0.83 |
PF00012 | HSP70 | 0.83 |
PF01850 | PIN | 0.83 |
PF13243 | SQHop_cyclase_C | 0.83 |
PF10091 | Glycoamylase | 0.83 |
PF01381 | HTH_3 | 0.83 |
PF10137 | TIR-like | 0.83 |
PF13607 | Succ_CoA_lig | 0.83 |
PF01610 | DDE_Tnp_ISL3 | 0.83 |
PF02786 | CPSase_L_D2 | 0.83 |
PF02518 | HATPase_c | 0.83 |
PF07883 | Cupin_2 | 0.83 |
PF13596 | PAS_10 | 0.83 |
PF10604 | Polyketide_cyc2 | 0.83 |
PF13492 | GAF_3 | 0.83 |
PF03450 | CO_deh_flav_C | 0.83 |
PF03466 | LysR_substrate | 0.83 |
PF00198 | 2-oxoacid_dh | 0.83 |
PF12833 | HTH_18 | 0.83 |
PF00432 | Prenyltrans | 0.83 |
PF13083 | KH_4 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 1.67 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.83 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.83 |
COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.83 |
COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.83 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.17 % |
Unclassified | root | N/A | 30.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10219785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 632 | Open in IMG/M |
3300001546|JGI12659J15293_10122978 | Not Available | 564 | Open in IMG/M |
3300001593|JGI12635J15846_10106071 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
3300001593|JGI12635J15846_10179480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
3300005167|Ga0066672_10047287 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
3300005534|Ga0070735_10685036 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300005537|Ga0070730_10017133 | All Organisms → cellular organisms → Bacteria | 5723 | Open in IMG/M |
3300005540|Ga0066697_10526266 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005541|Ga0070733_10457678 | Not Available | 852 | Open in IMG/M |
3300005541|Ga0070733_10497005 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300005542|Ga0070732_10346249 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005542|Ga0070732_10720468 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005591|Ga0070761_10151506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1358 | Open in IMG/M |
3300005764|Ga0066903_107003513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
3300006059|Ga0075017_100027885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3707 | Open in IMG/M |
3300006059|Ga0075017_100723326 | Not Available | 766 | Open in IMG/M |
3300006173|Ga0070716_101329134 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006173|Ga0070716_101824539 | Not Available | 504 | Open in IMG/M |
3300006175|Ga0070712_100622259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 915 | Open in IMG/M |
3300006791|Ga0066653_10530011 | Not Available | 596 | Open in IMG/M |
3300006796|Ga0066665_10460618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
3300006893|Ga0073928_10097882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2469 | Open in IMG/M |
3300009012|Ga0066710_100640778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1615 | Open in IMG/M |
3300009029|Ga0066793_10475043 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009038|Ga0099829_10382375 | Not Available | 1162 | Open in IMG/M |
3300009038|Ga0099829_11109707 | Not Available | 656 | Open in IMG/M |
3300009089|Ga0099828_10210430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
3300009089|Ga0099828_10793314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
3300009148|Ga0105243_11408578 | Not Available | 718 | Open in IMG/M |
3300009162|Ga0075423_13074802 | Not Available | 511 | Open in IMG/M |
3300009547|Ga0116136_1043393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
3300009624|Ga0116105_1188662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Nitrococcus → Nitrococcus mobilis | 564 | Open in IMG/M |
3300009631|Ga0116115_1067741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
3300009632|Ga0116102_1064596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
3300009633|Ga0116129_1002586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 9117 | Open in IMG/M |
3300009633|Ga0116129_1219635 | Not Available | 539 | Open in IMG/M |
3300009636|Ga0116112_1124318 | Not Available | 722 | Open in IMG/M |
3300009764|Ga0116134_1057750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
3300010048|Ga0126373_10970691 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300010360|Ga0126372_11861225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300010361|Ga0126378_10236740 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
3300010376|Ga0126381_100243104 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
3300010379|Ga0136449_100441633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2287 | Open in IMG/M |
3300010379|Ga0136449_103229398 | Not Available | 629 | Open in IMG/M |
3300011120|Ga0150983_13717967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300011269|Ga0137392_10539148 | Not Available | 969 | Open in IMG/M |
3300011270|Ga0137391_10908678 | Not Available | 720 | Open in IMG/M |
3300011271|Ga0137393_10449918 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300012096|Ga0137389_11167816 | Not Available | 659 | Open in IMG/M |
3300012189|Ga0137388_10998099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300012205|Ga0137362_10337946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1304 | Open in IMG/M |
3300012206|Ga0137380_11736704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Rickettsiella → unclassified Rickettsiella → Rickettsiella endosymbiont of Dermanyssus gallinae | 508 | Open in IMG/M |
3300012207|Ga0137381_11192885 | Not Available | 654 | Open in IMG/M |
3300012924|Ga0137413_10035126 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
3300014156|Ga0181518_10096997 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300014158|Ga0181521_10143134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1386 | Open in IMG/M |
3300014159|Ga0181530_10151093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
3300014159|Ga0181530_10324862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300014501|Ga0182024_11483923 | Not Available | 775 | Open in IMG/M |
3300014839|Ga0182027_11019025 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 846 | Open in IMG/M |
3300014968|Ga0157379_11801379 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300015193|Ga0167668_1024750 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300015195|Ga0167658_1000050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 84566 | Open in IMG/M |
3300015264|Ga0137403_10797628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 800 | Open in IMG/M |
3300017931|Ga0187877_1233752 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales | 713 | Open in IMG/M |
3300017946|Ga0187879_10016859 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
3300017948|Ga0187847_10016762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4621 | Open in IMG/M |
3300017948|Ga0187847_10308137 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300018012|Ga0187810_10134325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 987 | Open in IMG/M |
3300018042|Ga0187871_10147778 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300018058|Ga0187766_11377461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 517 | Open in IMG/M |
3300018062|Ga0187784_10225442 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300018086|Ga0187769_10841661 | Not Available | 694 | Open in IMG/M |
3300019888|Ga0193751_1115206 | Not Available | 1011 | Open in IMG/M |
3300020580|Ga0210403_10871021 | Not Available | 712 | Open in IMG/M |
3300020583|Ga0210401_10806625 | Not Available | 798 | Open in IMG/M |
3300020583|Ga0210401_10901791 | Not Available | 743 | Open in IMG/M |
3300022532|Ga0242655_10269699 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300022557|Ga0212123_10136489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1919 | Open in IMG/M |
3300022557|Ga0212123_10572620 | Not Available | 718 | Open in IMG/M |
3300025905|Ga0207685_10123367 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300026142|Ga0207698_11643723 | Not Available | 658 | Open in IMG/M |
3300026557|Ga0179587_10140685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1497 | Open in IMG/M |
3300027535|Ga0209734_1095267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
3300027559|Ga0209222_1038322 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300027645|Ga0209117_1061833 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300027678|Ga0209011_1020321 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
3300027698|Ga0209446_1010220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2301 | Open in IMG/M |
3300027812|Ga0209656_10180162 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300027812|Ga0209656_10337316 | Not Available | 688 | Open in IMG/M |
3300027824|Ga0209040_10369776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 675 | Open in IMG/M |
3300027875|Ga0209283_10407947 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300027903|Ga0209488_10295718 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300029944|Ga0311352_10970270 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300029990|Ga0311336_10401171 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300030618|Ga0311354_11719747 | Not Available | 547 | Open in IMG/M |
3300031028|Ga0302180_10525016 | Not Available | 578 | Open in IMG/M |
3300031234|Ga0302325_12322206 | Not Available | 647 | Open in IMG/M |
3300031236|Ga0302324_100390463 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
3300031236|Ga0302324_102528144 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031241|Ga0265325_10396183 | Not Available | 605 | Open in IMG/M |
3300031242|Ga0265329_10179427 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300031708|Ga0310686_107651609 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300031708|Ga0310686_109719202 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
3300031718|Ga0307474_11669199 | Not Available | 500 | Open in IMG/M |
3300031726|Ga0302321_100231521 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300031910|Ga0306923_12015818 | Not Available | 585 | Open in IMG/M |
3300031962|Ga0307479_11300064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300032160|Ga0311301_11739957 | Not Available | 747 | Open in IMG/M |
3300032180|Ga0307471_100571129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
3300032805|Ga0335078_10536495 | Not Available | 1493 | Open in IMG/M |
3300032828|Ga0335080_11911632 | Not Available | 577 | Open in IMG/M |
3300032829|Ga0335070_10327489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1479 | Open in IMG/M |
3300032892|Ga0335081_10667973 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300032892|Ga0335081_11124763 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300033158|Ga0335077_11544397 | Not Available | 634 | Open in IMG/M |
3300033289|Ga0310914_11672247 | Not Available | 540 | Open in IMG/M |
3300033412|Ga0310810_10000287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 52595 | Open in IMG/M |
3300033417|Ga0214471_11123165 | Not Available | 601 | Open in IMG/M |
3300034125|Ga0370484_0007101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfohalobium → Desulfohalobium retbaense | 2300 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.33% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.33% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.67% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.83% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.83% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.83% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_102197851 | 3300000567 | Peatlands Soil | ETRMQVDAFLKEHEIHDYTATDFEQDREALRQLRMRETQP* |
JGI12659J15293_101229781 | 3300001546 | Forest Soil | FETRMQVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL* |
JGI12635J15846_101060712 | 3300001593 | Forest Soil | MQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR* |
JGI12635J15846_101794801 | 3300001593 | Forest Soil | VDAFLKEHEVYDFTAADFEQDRETLRQVRAREAQL* |
Ga0066672_100472875 | 3300005167 | Soil | TRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH* |
Ga0070735_106850361 | 3300005534 | Surface Soil | MQVDVFLKEHEVYDFTEADFEQDRETLRQLRGEDA* |
Ga0070730_100171335 | 3300005537 | Surface Soil | MQVDALLKEHEIFDYSAADFKQDLETLRELRMREVRP* |
Ga0066697_105262662 | 3300005540 | Soil | MQVDAFLKEHEIFDYSAADFEQDRETLWELRAREAQH* |
Ga0070733_104576781 | 3300005541 | Surface Soil | MSMQVDAFLKEHEILDFSAADFEQDRETLRELRMREARP* |
Ga0070733_104970053 | 3300005541 | Surface Soil | MAGHVLTARMQLDAFLKEHEVYDFTAADFEQDRDTPCQLRKRDAQH* |
Ga0070732_103462492 | 3300005542 | Surface Soil | MQVEAFLKEHEIYDYSVADFEQDRETLRNLRTSEA* |
Ga0070732_107204682 | 3300005542 | Surface Soil | MQVDVFLKEHEVYDFTMADFEQDRETLRGLRTREAQH* |
Ga0070761_101515062 | 3300005591 | Soil | LVFETQMQVDAFLKEHEIFDYSADDFEQDRETLRELRMRELRP* |
Ga0066903_1070035131 | 3300005764 | Tropical Forest Soil | MQVDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH* |
Ga0075017_1000278851 | 3300006059 | Watersheds | QVDEFLKEHEVYDFTAADFEQDRQTLREFRIGQSRR* |
Ga0075017_1007233262 | 3300006059 | Watersheds | RMQVDAFLKEHEVFDFTAADFEQDRETLRQLRVREARL* |
Ga0070716_1013291342 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP* |
Ga0070716_1018245391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQVDAFLKEHEIFDYSAADFEKDRETLRGIRMREGRP* |
Ga0070712_1006222592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DTGMQVDAFLKEHEICDYSIGDFEQDRATLREIRMQEPRL* |
Ga0066653_105300113 | 3300006791 | Soil | MQVDAFLEEHEIFDYSAADFEQDRETLWELRAREAQH* |
Ga0066665_104606181 | 3300006796 | Soil | DAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH* |
Ga0073928_100978822 | 3300006893 | Iron-Sulfur Acid Spring | MQVDAFLKEHEFYDFTAADFEQDRETLRQLRARNSVKT* |
Ga0066710_1006407784 | 3300009012 | Grasslands Soil | MQVDAFLKEHEIFDYSAADFEQDRETLWELRAREAQH |
Ga0066793_104750431 | 3300009029 | Prmafrost Soil | MQVDAFLKEHEIYDYSVADFEQDRETLRELRMREARP* |
Ga0099829_103823752 | 3300009038 | Vadose Zone Soil | FETRMQVDAFLREHEVYDFTAADFEQDEETLRQLRAREAQV* |
Ga0099829_111097071 | 3300009038 | Vadose Zone Soil | MQVDAFLKEHDVYDFTAADFEQDRETLRQLRVREAQR* |
Ga0099828_102104301 | 3300009089 | Vadose Zone Soil | MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREGSA* |
Ga0099828_107933141 | 3300009089 | Vadose Zone Soil | MQVDALLKEHEIFDYSAADFEQDRETLREHRMRKALP* |
Ga0105243_114085782 | 3300009148 | Miscanthus Rhizosphere | MQVDTFLKEHEVYDFTAADFEQDRETLRQLRMRVPQL* |
Ga0075423_130748021 | 3300009162 | Populus Rhizosphere | RMQVDAFLKEHEVFDFTATDFERDRETLRQLRAR* |
Ga0116136_10433932 | 3300009547 | Peatland | MQADAFLKEHEVYDFAAADFEQDCETLRQVRMREA* |
Ga0116105_11886621 | 3300009624 | Peatland | QLDAFLKEHEVYDFSAADFEQDRETLCHLRKRDAQH* |
Ga0116115_10677411 | 3300009631 | Peatland | MQTDAFLKEHEVYDFTVADFKQDCETLRQVRMREA* |
Ga0116102_10645962 | 3300009632 | Peatland | MQVGAFLKEHEIFDYSAADFEQDRETLQEIRMREARP* |
Ga0116129_10025861 | 3300009633 | Peatland | MQVDAFLKEHEVYDLTVADFEQDRETLRQLRAGEAQL* |
Ga0116129_12196351 | 3300009633 | Peatland | LQVEAFLKEHEVYEFTAADFKQDRETLRQLRVREAQN* |
Ga0116112_11243181 | 3300009636 | Peatland | QVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL* |
Ga0116134_10577501 | 3300009764 | Peatland | MQVDAFLKEHEVYDFTAADFEQDRETLRKLRARKAKR* |
Ga0126373_109706911 | 3300010048 | Tropical Forest Soil | RMQVDAFLKEHEVYDFTAADFEHDRETLRELRTREAQH* |
Ga0126372_118612252 | 3300010360 | Tropical Forest Soil | VDAFLKEHEVYDFTAADFEHDRETLRELRTREAQH* |
Ga0126378_102367401 | 3300010361 | Tropical Forest Soil | ETRMQVDAFLKEHEIYDFTAADFEQDRETLRQLRSE* |
Ga0126381_1002431041 | 3300010376 | Tropical Forest Soil | MQVDAFLKEHEVYDFTVADFEQDRETLRQLRAGEAQH* |
Ga0136449_1004416332 | 3300010379 | Peatlands Soil | MEVDAFLKEHEVFDYSAADFELDRETLRDLRMREARP* |
Ga0136449_1032293981 | 3300010379 | Peatlands Soil | RLLVFETRMQVDAFLKEHEVYDFTVEDFKQDCETLRQISGKGTQH* |
Ga0150983_137179671 | 3300011120 | Forest Soil | VDAFLKEHEIFDYSTADFEQDCETLRELRMREARP* |
Ga0137392_105391482 | 3300011269 | Vadose Zone Soil | MEVDAFLKEHEIFEYSAADFEQDRETLREHRMRKALP* |
Ga0137391_109086782 | 3300011270 | Vadose Zone Soil | STPFLKEHEIFDYSAADFEQDRETLREHRMRKALP* |
Ga0137393_104499181 | 3300011271 | Vadose Zone Soil | DAFLKEHEIFDYSAADFEQDRETLRELRMREVRP* |
Ga0137389_111678162 | 3300012096 | Vadose Zone Soil | DDFLKEHDIFDYSASEFEQDRETLRELRMREVRP* |
Ga0137388_109980991 | 3300012189 | Vadose Zone Soil | MQVDAFLKEHEVFDYSAADFEQDRETLRELRMREARP* |
Ga0137362_103379464 | 3300012205 | Vadose Zone Soil | ETRMQVVAFLKEHEVYDFTASDFEQDRETLRQLRVREARL* |
Ga0137380_117367042 | 3300012206 | Vadose Zone Soil | PAPAFETRMQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR* |
Ga0137381_111928852 | 3300012207 | Vadose Zone Soil | GFETRMQVDAFLKEHEVYDFTAADFEQDRETLRQVRVREARL* |
Ga0137413_100351261 | 3300012924 | Vadose Zone Soil | MQVDALLKEHEIFDYSAADFELDRETLRELRMREARP* |
Ga0181518_100969973 | 3300014156 | Bog | FETRMQVDDFLKEHEVYDFIVEDFKQDCETLRQLRTREA* |
Ga0181521_101431341 | 3300014158 | Bog | MQLDAFLKEHEVYDFTAADFEQDRETLCQLRKRDAQH* |
Ga0181530_101510931 | 3300014159 | Bog | RMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVREVRL* |
Ga0181530_103248622 | 3300014159 | Bog | MQVDAFLREHEIFDYSAADFERDRETLRQFRVREAQH* |
Ga0182024_114839231 | 3300014501 | Permafrost | DAFLKEHEIFDYSAADFEQDRETLRELRMRELRP* |
Ga0182027_110190253 | 3300014839 | Fen | MQVDAFLKEHEIYDYTAADFEQDRETLRQLRMGQARP* |
Ga0157379_118013793 | 3300014968 | Switchgrass Rhizosphere | LAFETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVKDGQR* |
Ga0167668_10247503 | 3300015193 | Glacier Forefield Soil | MQVDAFLKEHEIYDYSVADFEQDRKTLRKIRMRETQR* |
Ga0167658_100005040 | 3300015195 | Glacier Forefield Soil | MQVDGFLKDHEIYDSSVEDFEQDRETLRRLRMKDAQP* |
Ga0137403_107976281 | 3300015264 | Vadose Zone Soil | MQVDAFLKEHEIYDYSVADFEQDRETLRKLRMRETQR* |
Ga0187877_12337523 | 3300017931 | Peatland | ANAGGRAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL |
Ga0187879_100168594 | 3300017946 | Peatland | MQTDAFLKEHEVYDFTVADFKQDCETLRQVRMREA |
Ga0187847_100167621 | 3300017948 | Peatland | DFLKEHEVYDFTVEDFKQDCETLRQVRARELSPGA |
Ga0187847_103081371 | 3300017948 | Peatland | VDGFLKEHEVYDFTVADFGQDCETLRQVRTREAQS |
Ga0187810_101343252 | 3300018012 | Freshwater Sediment | ETQMQVDAFLKEHEICDYSADDFEQDRETLRELRMRELRP |
Ga0187871_101477782 | 3300018042 | Peatland | MQVEEFLAQHEVFGFTAADFERDRETLRQLRASEPLR |
Ga0187766_113774611 | 3300018058 | Tropical Peatland | QVDAFLKEHEVYDFTAADFEQDRETLRQLRLREAQQ |
Ga0187784_102254424 | 3300018062 | Tropical Peatland | GFETRMQVDAFLKQHEICDYTAVDFERDRETLRQIPKR |
Ga0187769_108416611 | 3300018086 | Tropical Peatland | MQVDAFLTEREVYDFTAADLEQDRETLGQLRPKQGQLRR |
Ga0193751_11152063 | 3300019888 | Soil | ETRMQVDTFLKEHEVFDFTAADFEQDRETLRQLRATEPQR |
Ga0210403_108710212 | 3300020580 | Soil | RMQVDAFLKEHEVYDLTVADFEQDRETLRQLRAREAQL |
Ga0210401_108066252 | 3300020583 | Soil | RMQVDAFLKEHEVYDFTAVDFEQDRETLCQLRKRDVQH |
Ga0210401_109017911 | 3300020583 | Soil | ADSFLKEHEAYDFTAADFERDRETLRQLRARELQH |
Ga0242655_102696992 | 3300022532 | Soil | VFGTRMQVDAFLKEHEIFDYSAADFEQDRETLRGIRMREARP |
Ga0212123_101364894 | 3300022557 | Iron-Sulfur Acid Spring | MQVDAFLKEHEFYDFTAADFEQDRETLRQLRARNSVKT |
Ga0212123_105726202 | 3300022557 | Iron-Sulfur Acid Spring | TRIQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP |
Ga0207685_101233673 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QVDAFLKEHEVYDFTADDFEQDRETLRQLRVKEAQL |
Ga0207698_116437231 | 3300026142 | Corn Rhizosphere | RMQVDAFLKEHEVFDFTMTDFEQDRETLRQLRAREAQR |
Ga0179587_101406852 | 3300026557 | Vadose Zone Soil | MQVDALLKEHEIFDYSAADFELDRETLRELRMREARP |
Ga0209734_10952672 | 3300027535 | Forest Soil | AFGTRMQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR |
Ga0209222_10383221 | 3300027559 | Forest Soil | LAFETRTQIDAFLKEHEIFDYSASDFEQDRETLRQLRVKEAQH |
Ga0209117_10618331 | 3300027645 | Forest Soil | FETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRVREARL |
Ga0209011_10203212 | 3300027678 | Forest Soil | MQVDAFSKEHEVYDFTAADFEQDRETLRQLRAREAQR |
Ga0209446_10102204 | 3300027698 | Bog Forest Soil | MQVDAFLKEHEIFDYSAADFEQDRETLWELRMSEAQP |
Ga0209656_101801623 | 3300027812 | Bog Forest Soil | RMQVDAFLKEHEVFDFTVEDFERDRETLRQLRLRVT |
Ga0209656_103373162 | 3300027812 | Bog Forest Soil | FETRMQVDAFLKEHEIFDYSAADFEQDRETLRELRMREAQP |
Ga0209040_103697762 | 3300027824 | Bog Forest Soil | RMQVDAFLKEHEIFDYSAADFEKDRETLRGIRMREARP |
Ga0209283_104079471 | 3300027875 | Vadose Zone Soil | AFETRMQVDAFLKEHEIFDYSAADFEQDRETLRELRMREGSA |
Ga0209488_102957181 | 3300027903 | Vadose Zone Soil | RMQVDALLKEHEIFDYSAADFEQDRETLRELRMREARP |
Ga0311352_109702701 | 3300029944 | Palsa | GFETRMQVDSFLKEHEVYDFTAANFERDRETLRQLRASEGQR |
Ga0311336_104011711 | 3300029990 | Fen | FETRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI |
Ga0311354_117197471 | 3300030618 | Palsa | ETHMQADAFLKEHEVYEFTMEDFKQDCETLRQVRAREA |
Ga0302180_105250161 | 3300031028 | Palsa | MQVDAFLKEHEVFDYSAADFEQDRETLRELRMREARS |
Ga0302325_123222061 | 3300031234 | Palsa | VDAFLKEHEVYDFSAADFEQDRETLCHLRKRDAQH |
Ga0302324_1003904634 | 3300031236 | Palsa | AFETRMHVDAFLKEHEIFDYSAADFERDRETLRELRMREARP |
Ga0302324_1025281441 | 3300031236 | Palsa | FETRMQVDAFLKEHEIFDYTAADFEQDRETLRQLRMREAQP |
Ga0265325_103961831 | 3300031241 | Rhizosphere | RLLLGFETRMQMEDFLSKHEVFEFTAADFEQDRETLRQFRANEER |
Ga0265329_101794271 | 3300031242 | Rhizosphere | LLGFETRMQMEDFLSKHEVFEFTAADFEQDRETLRQFRANEER |
Ga0310686_1076516094 | 3300031708 | Soil | MEVDAFLKEHQIFDYSAADFEQDRETLRGIRMTEARP |
Ga0310686_1097192023 | 3300031708 | Soil | MQLDAFLKQHEVFDYSAADFEQDRETLRELRMREARP |
Ga0307474_116691993 | 3300031718 | Hardwood Forest Soil | MQVDAFLKEHEIFDYSAADFEQDRETLRELRMREARP |
Ga0302321_1002315211 | 3300031726 | Fen | TRMQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI |
Ga0306923_120158182 | 3300031910 | Soil | MQMDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH |
Ga0307479_113000641 | 3300031962 | Hardwood Forest Soil | MEVDAFLKEHEIFDYSAPDFEQDRETLRDLRMRELRP |
Ga0311301_117399572 | 3300032160 | Peatlands Soil | MEVDAFLKEHEVFDYSAADFELDRETLRDLRMREARP |
Ga0307471_1005711292 | 3300032180 | Hardwood Forest Soil | MQVDAFLKEQEIYDYSVEDFEQDRETLRELRMREARR |
Ga0335078_105364954 | 3300032805 | Soil | RMQVDAFLKEHEVYDFTAVDFEQDRETLRQLRAREAQH |
Ga0335080_119116321 | 3300032828 | Soil | ETRMQVDDFLKEHEVYDLTVADFKQDCKTLRQVRMRET |
Ga0335070_103274893 | 3300032829 | Soil | MQVEAFLKEHDVYDFTAAGFEPGRVRLRQLRAREAQS |
Ga0335081_106679732 | 3300032892 | Soil | MQLDAFLKEHEIYDYTAADFEQDRETLRQVRMREAQT |
Ga0335081_111247631 | 3300032892 | Soil | TRMQCDAFLKEHEIFDYSVADFEQDRETLRDLRSRDARP |
Ga0335077_115443971 | 3300033158 | Soil | QLDAFLKEHEIYDYTAADFEQDRETLRQVRMREAQT |
Ga0310914_116722471 | 3300033289 | Soil | LGFQTSMQMDAFLKEHEVYDFTAADFEQDRETLRQLRAREAQH |
Ga0310810_100002874 | 3300033412 | Soil | MQVDAFLKEHEVYDFTAADFEQDCETLRQLPMKEAQH |
Ga0214471_111231652 | 3300033417 | Soil | MQVDAFLKEHEVYDFKAADFEQDRETLRQLRAREAQR |
Ga0370484_0007101_54_167 | 3300034125 | Untreated Peat Soil | MQVDAFLKEHEVYDFTAADFEQDRETLRQLRATEAQI |
⦗Top⦘ |