Basic Information | |
---|---|
Family ID | F073737 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 47 residues |
Representative Sequence | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVARQEQI |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.60 % |
% of genes near scaffold ends (potentially truncated) | 85.83 % |
% of genes from short scaffolds (< 2000 bps) | 80.00 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.167 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.46% β-sheet: 0.00% Coil/Unstructured: 40.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF01243 | Putative_PNPOx | 13.33 |
PF02738 | MoCoBD_1 | 12.50 |
PF13561 | adh_short_C2 | 6.67 |
PF00296 | Bac_luciferase | 4.17 |
PF13354 | Beta-lactamase2 | 3.33 |
PF01557 | FAA_hydrolase | 0.83 |
PF00034 | Cytochrom_C | 0.83 |
PF12680 | SnoaL_2 | 0.83 |
PF01596 | Methyltransf_3 | 0.83 |
PF13439 | Glyco_transf_4 | 0.83 |
PF00383 | dCMP_cyt_deam_1 | 0.83 |
PF13180 | PDZ_2 | 0.83 |
PF13280 | WYL | 0.83 |
PF14559 | TPR_19 | 0.83 |
PF02129 | Peptidase_S15 | 0.83 |
PF07969 | Amidohydro_3 | 0.83 |
PF13533 | Biotin_lipoyl_2 | 0.83 |
PF07687 | M20_dimer | 0.83 |
PF06689 | zf-C4_ClpX | 0.83 |
PF00529 | CusB_dom_1 | 0.83 |
PF02543 | Carbam_trans_N | 0.83 |
PF16861 | Carbam_trans_C | 0.83 |
PF08241 | Methyltransf_11 | 0.83 |
PF08386 | Abhydrolase_4 | 0.83 |
PF00441 | Acyl-CoA_dh_1 | 0.83 |
PF01432 | Peptidase_M3 | 0.83 |
PF00254 | FKBP_C | 0.83 |
PF13231 | PMT_2 | 0.83 |
PF01425 | Amidase | 0.83 |
PF07732 | Cu-oxidase_3 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.17 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.83 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.83 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.83 |
COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.83 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.83 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.33 % |
Unclassified | root | N/A | 6.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1023211 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300000709|KanNP_Total_F14TBDRAFT_1008617 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300000955|JGI1027J12803_100339172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1805 | Open in IMG/M |
3300002560|JGI25383J37093_10022507 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300002562|JGI25382J37095_10013595 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
3300004268|Ga0066398_10157255 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
3300004633|Ga0066395_10152472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1172 | Open in IMG/M |
3300005167|Ga0066672_10312350 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300005171|Ga0066677_10396757 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005176|Ga0066679_10750889 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005271|Ga0065713_1013318 | Not Available | 500 | Open in IMG/M |
3300005334|Ga0068869_101097139 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300005356|Ga0070674_102147226 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 510 | Open in IMG/M |
3300005545|Ga0070695_100516197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300005546|Ga0070696_100389067 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300005558|Ga0066698_10411158 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005559|Ga0066700_10064102 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300005564|Ga0070664_101516903 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005569|Ga0066705_10551162 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300005598|Ga0066706_11391802 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005618|Ga0068864_102066331 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005713|Ga0066905_100941310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 758 | Open in IMG/M |
3300005719|Ga0068861_102534595 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005764|Ga0066903_100561440 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300006031|Ga0066651_10813026 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006049|Ga0075417_10143539 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300006058|Ga0075432_10137006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 931 | Open in IMG/M |
3300006196|Ga0075422_10086200 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300006358|Ga0068871_100895641 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300006796|Ga0066665_11001312 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300006844|Ga0075428_101173033 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300006852|Ga0075433_10621743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300006871|Ga0075434_100014383 | All Organisms → cellular organisms → Bacteria | 7563 | Open in IMG/M |
3300006880|Ga0075429_100763455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 847 | Open in IMG/M |
3300006881|Ga0068865_101069456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
3300006904|Ga0075424_101074461 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300007265|Ga0099794_10038014 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
3300009012|Ga0066710_102217962 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300009012|Ga0066710_102624303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 723 | Open in IMG/M |
3300009038|Ga0099829_10989803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 697 | Open in IMG/M |
3300009137|Ga0066709_100349284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2032 | Open in IMG/M |
3300009137|Ga0066709_100649272 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1510 | Open in IMG/M |
3300009147|Ga0114129_12923944 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300009176|Ga0105242_12867354 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
3300010047|Ga0126382_10592892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300010304|Ga0134088_10228090 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 894 | Open in IMG/M |
3300010361|Ga0126378_11017229 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300010362|Ga0126377_10278308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1641 | Open in IMG/M |
3300010362|Ga0126377_11508540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 746 | Open in IMG/M |
3300010400|Ga0134122_10018682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5193 | Open in IMG/M |
3300012200|Ga0137382_10392425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 977 | Open in IMG/M |
3300012202|Ga0137363_11591023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300012206|Ga0137380_11416683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300012349|Ga0137387_10413423 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300012582|Ga0137358_10262229 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1175 | Open in IMG/M |
3300012582|Ga0137358_10381299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 954 | Open in IMG/M |
3300012923|Ga0137359_11113218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300012925|Ga0137419_10382413 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1096 | Open in IMG/M |
3300012925|Ga0137419_10605164 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300012925|Ga0137419_11499589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300012972|Ga0134077_10259976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
3300015054|Ga0137420_1400594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
3300015241|Ga0137418_11304572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11 | 506 | Open in IMG/M |
3300015245|Ga0137409_10022444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6192 | Open in IMG/M |
3300015245|Ga0137409_10071802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3244 | Open in IMG/M |
3300015357|Ga0134072_10185476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300015373|Ga0132257_104645238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
3300016387|Ga0182040_10075096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2207 | Open in IMG/M |
3300018052|Ga0184638_1265918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 586 | Open in IMG/M |
3300018056|Ga0184623_10508450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 513 | Open in IMG/M |
3300018075|Ga0184632_10425024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 554 | Open in IMG/M |
3300018082|Ga0184639_10006725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5392 | Open in IMG/M |
3300018468|Ga0066662_11047573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
3300019259|Ga0184646_1265741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1077 | Open in IMG/M |
3300019789|Ga0137408_1008739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2413 | Open in IMG/M |
3300020170|Ga0179594_10354736 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
3300020199|Ga0179592_10195442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11 | 918 | Open in IMG/M |
3300021090|Ga0210377_10062218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2556 | Open in IMG/M |
3300025937|Ga0207669_10692565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 837 | Open in IMG/M |
3300025938|Ga0207704_10915968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
3300025942|Ga0207689_10894542 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300026035|Ga0207703_11015302 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
3300026317|Ga0209154_1172468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 875 | Open in IMG/M |
3300026326|Ga0209801_1258074 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300026523|Ga0209808_1088278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1326 | Open in IMG/M |
3300026548|Ga0209161_10476489 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026550|Ga0209474_10218131 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300026550|Ga0209474_10448632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 656 | Open in IMG/M |
3300027561|Ga0209887_1096513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 600 | Open in IMG/M |
3300027671|Ga0209588_1253353 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027748|Ga0209689_1050151 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
3300027873|Ga0209814_10126958 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300027874|Ga0209465_10248195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 890 | Open in IMG/M |
3300027880|Ga0209481_10305184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
3300027902|Ga0209048_10240708 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300027907|Ga0207428_11189312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
3300028536|Ga0137415_10045080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4298 | Open in IMG/M |
3300030620|Ga0302046_10375009 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1005134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2553 | Open in IMG/M |
3300031184|Ga0307499_10083513 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 847 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1034708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1206 | Open in IMG/M |
3300031455|Ga0307505_10387006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 664 | Open in IMG/M |
3300031720|Ga0307469_10065438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2377 | Open in IMG/M |
3300031720|Ga0307469_10197042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1568 | Open in IMG/M |
3300031720|Ga0307469_11900283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 576 | Open in IMG/M |
3300031796|Ga0318576_10567821 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
3300031945|Ga0310913_11008717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
3300032039|Ga0318559_10481213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
3300032043|Ga0318556_10726826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300032180|Ga0307471_100009552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6433 | Open in IMG/M |
3300032205|Ga0307472_102587225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
3300033416|Ga0316622_100811379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
3300033513|Ga0316628_102951133 | Not Available | 623 | Open in IMG/M |
3300034085|Ga0373908_092456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.17% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.50% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.67% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.83% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Miscanthus Rhizosphere | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005271 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample from Bulk Soil Replicate 2: eDNA_1 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034085 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.3 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
KanNP_Total_noBrdU_T14TCDRAFT_10232112 | 3300000596 | Soil | MESDEIQKLLREIRDTQREHLAEYRQVTQRSLELQQRAVARQ |
KanNP_Total_F14TBDRAFT_10086172 | 3300000709 | Soil | MESDEIQKLLREIRDTQREHLAEYRQVTQRSLELQQRAVARQEQIG |
JGI1027J12803_1003391723 | 3300000955 | Soil | MQSDDDVRQLLRDIRDAQREQLAEHRGVMDRVLELQRRA |
JGI25383J37093_100225071 | 3300002560 | Grasslands Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVARQEQI |
JGI25382J37095_100135953 | 3300002562 | Grasslands Soil | MDSEEEIRQLLRDIRDAQREHLAEYRRVAERSLELQQRAVARQEQM |
Ga0066398_101572552 | 3300004268 | Tropical Forest Soil | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQQRAVARQEQIGRF |
Ga0066395_101524721 | 3300004633 | Tropical Forest Soil | MDKDDDVRHLLRDIRDAQRDQLAEYRGLLERVLELQQRAVAQ |
Ga0066672_103123503 | 3300005167 | Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGQLYRRLMLVGGVL |
Ga0066677_103967571 | 3300005171 | Soil | MERDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIG |
Ga0066679_107508892 | 3300005176 | Soil | MEGDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRRL |
Ga0065713_10133182 | 3300005271 | Miscanthus Rhizosphere | VPESDEVKELLTEIRDLQREQLAHYRQVTQRSLELQQQAEKE |
Ga0068869_1010971391 | 3300005334 | Miscanthus Rhizosphere | MDNDDRVVTLLQEIRDAQREHLAEYRKVAQRSVELQEEAVARQQNYGNMYR |
Ga0070674_1021472262 | 3300005356 | Miscanthus Rhizosphere | MDNDEIGRLLQETRDTQREHLAEYRRVTERSLELQQRAVTRQEQFGNLYRRILAVGGG |
Ga0070695_1005161973 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAGDGIRRLLEEIRDLQREHLEEYRKVTTRSLELQQRAVAKQEQFGGVYRKAVLVS |
Ga0070696_1003890671 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKETDEIKQLLSEIRDLQRESLGEYRRVTQRSLDLQQQAVTRQ |
Ga0066698_104111581 | 3300005558 | Soil | VTDDEVRQLLRDIRDAQREQLAEYRRVTERSLELQQRAVTRQEQLGQVYRRLMA |
Ga0066698_105635201 | 3300005558 | Soil | VNEDDEIRQLLRDIRDAQREHGAEYRRVTERLVELQERAVTQQEQLGGLYRRL |
Ga0066700_100641023 | 3300005559 | Soil | MERDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRYLFATGIVGVG* |
Ga0070664_1015169032 | 3300005564 | Corn Rhizosphere | MQESQEIKELLKEIRDGQKEHLAEYRRVAERSLELQQQAVARQEK |
Ga0066705_105511621 | 3300005569 | Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTR |
Ga0066706_113918022 | 3300005598 | Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQR |
Ga0068864_1020663312 | 3300005618 | Switchgrass Rhizosphere | MDNDDRVVTLLQEIRDAQREHLAEYRKVAQRSVELQEEAVARQQNYGNMYRRIVA |
Ga0066905_1009413101 | 3300005713 | Tropical Forest Soil | MDKDDDVRHLLRDIRDAQRDQLAEYRGLVERVLEL |
Ga0068861_1025345952 | 3300005719 | Switchgrass Rhizosphere | MDGGDEIRQLLREIRDAQREHLAEYRRVADRSLELQQRAVARQEQIGQLSRRLIGVGGILVVALFA |
Ga0066903_1005614401 | 3300005764 | Tropical Forest Soil | MDSDDDVRHLLRDIRDAQRDQLAEYRTLLERVLELQQRAV |
Ga0066651_108130262 | 3300006031 | Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQ |
Ga0075417_101435391 | 3300006049 | Populus Rhizosphere | MDDGNEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVARQE |
Ga0075432_101370061 | 3300006058 | Populus Rhizosphere | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQHRAVARQEQIGRFT |
Ga0075422_100862003 | 3300006196 | Populus Rhizosphere | MDGSDEIRQLLREIRDTQREQLAEYRKVAERSLELQQRA |
Ga0068871_1008956411 | 3300006358 | Miscanthus Rhizosphere | MDNDDRVVTLLQEIRDAQREHLAEYRKVAQRSVELQEEAVARQQNYG |
Ga0066665_110013122 | 3300006796 | Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVAR |
Ga0075428_1011730332 | 3300006844 | Populus Rhizosphere | MNGDPEIRQLLTEIRDTQREHLAEYRRVTERSLELQQRAVARQ |
Ga0075433_106217433 | 3300006852 | Populus Rhizosphere | MQNSDEIKKILVEIRDAQIEQLAEYRKVTQRSLELQEKAV |
Ga0075434_1000143835 | 3300006871 | Populus Rhizosphere | MQSDDDVRQLLRDIRDAQREQLAEHRGVMDRVLELQRRAVVQQEQ |
Ga0075429_1007634553 | 3300006880 | Populus Rhizosphere | MTDVQGDDIRQLLREIRDAQREQLAEYRRVTERSLEL |
Ga0068865_1010694562 | 3300006881 | Miscanthus Rhizosphere | MQSDDDVRQLLRDIRDAQREQLAEHRSVMDRVLELQR |
Ga0075424_1010744611 | 3300006904 | Populus Rhizosphere | MTSEEELRRLLTEIRDIQRDHLAEYRRVTERSLDLQQRA |
Ga0099794_100380143 | 3300007265 | Vadose Zone Soil | MERDDETHRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRYLFVTGIVGVG* |
Ga0066710_1022179621 | 3300009012 | Grasslands Soil | MEGDAIQKLLREIRDTQREHLAEYRQVTQRSLELQQR |
Ga0066710_1026243032 | 3300009012 | Grasslands Soil | MEESDELKLLTEIRDAQREHLTEYRKVAQESLALQKQAVARQEQIAKLYRAWL |
Ga0099829_109898031 | 3300009038 | Vadose Zone Soil | MEGEEEIRQLLREIRDTQREHLAEYRRVAERTLDLQQRALAGREQLSRVSVTQQFW* |
Ga0066709_1003492841 | 3300009137 | Grasslands Soil | MTSEGEVRVLLREIRDTQREHLAEYRRVTERSLDLQQRA |
Ga0066709_1006492721 | 3300009137 | Grasslands Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQ |
Ga0114129_129239442 | 3300009147 | Populus Rhizosphere | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQHR |
Ga0105242_106320771 | 3300009176 | Miscanthus Rhizosphere | MEESDQLKLLTEIRDAQREHLAEYRKVTQESLALQKQAVARQEQI |
Ga0105242_128673542 | 3300009176 | Miscanthus Rhizosphere | MDNDDRVVTLLQEIRDAQREHLAEYRKVAQRSVELQEEAVARQQNY |
Ga0126380_115476732 | 3300010043 | Tropical Forest Soil | MEQSDELKLLTEIRDAQREHLAEYRKVTEESLALQRQAV |
Ga0126382_105928921 | 3300010047 | Tropical Forest Soil | MDKDDDVGHLLRDIRDAQRDQLAEYRGLVERVLELQQ |
Ga0134088_102280901 | 3300010304 | Grasslands Soil | VESGDEIRRLLQEIRDIDREHLDEYRRVTTKSLELQQRAVARQ |
Ga0126378_110172293 | 3300010361 | Tropical Forest Soil | MDDDEIRQLLREIRDAQREHLAEYRRVTERSLELQQRAVARQEQFGHVYRRMA |
Ga0126377_102783083 | 3300010362 | Tropical Forest Soil | MEGDEIQKVLREIRDTQREHLAEYRSVTQRSLELQQRAVARQEQIGRF |
Ga0126377_115085401 | 3300010362 | Tropical Forest Soil | MNEDETQKLLREIRDTQREHLAEYRSVTQRSLDLQQRAVARQEQI |
Ga0134122_100186821 | 3300010400 | Terrestrial Soil | MDGGDEIRQLLREIRDAQREHLAEYRRVADRSLELQQRAVARQEQISQL |
Ga0137382_103924252 | 3300012200 | Vadose Zone Soil | MDNDEIGRLLQEIRDTQREHLAEYRRVTERSLELQQRAVTRQEQFGHLYRRIL |
Ga0137363_115910231 | 3300012202 | Vadose Zone Soil | MQSDDDVRQLLRDIRDAQREQLAEHRGVMDRVLELLRRAV |
Ga0137380_114166831 | 3300012206 | Vadose Zone Soil | MENDDEVRQLFRDIRDAHREQLAEYRRVTERSFELQQRAVA |
Ga0137387_104134231 | 3300012349 | Vadose Zone Soil | MEGDEIQTLRREIRATQREHLAEYRQVTQRSLELQQRAVTRQEQIGRFTRQIVLAGG |
Ga0137358_102622293 | 3300012582 | Vadose Zone Soil | MECDDETRRLLGEIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHRYRYLFVTGIVGVG* |
Ga0137358_103812992 | 3300012582 | Vadose Zone Soil | MERDDETRQLLREIRGAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRYLFVTGIVGVG* |
Ga0137359_111132183 | 3300012923 | Vadose Zone Soil | MDSENEVRQLLKEILDTQREHLAEYRRVTQRSLELQQRAVARQEQM |
Ga0137419_103824133 | 3300012925 | Vadose Zone Soil | MERDDETRRLLREIRDAQREQLAEYRRATERSLELQQRAVAR* |
Ga0137419_106051643 | 3300012925 | Vadose Zone Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHVYRRLV |
Ga0137419_114995891 | 3300012925 | Vadose Zone Soil | VPGPGNDDDEIRHLLRDIRDAQREHGAEYRRVTERLVELQERAV |
Ga0134077_102599762 | 3300012972 | Grasslands Soil | MEGDEIRQLLKEIRDTQREHLAEYRRVTERSLELQQRAVARQE |
Ga0137420_14005943 | 3300015054 | Vadose Zone Soil | MERDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLY |
Ga0137418_113045721 | 3300015241 | Vadose Zone Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHVYRRLVTV |
Ga0137409_100224448 | 3300015245 | Vadose Zone Soil | MEAGDEVRRLLEEIRDLQREHLEEYRRVTTRSLELQQRAVTRQE |
Ga0137409_100718026 | 3300015245 | Vadose Zone Soil | MEAGDEARRLLEEIRDLQREHLAEYRKVTERSLELQQRAV |
Ga0134072_101854761 | 3300015357 | Grasslands Soil | MERDDETRRLLREIRDAQREQLDEYRRVTERSLELQQRAVTRQEQIGHLYRRLMLVGGVLVAALL |
Ga0132257_1046452382 | 3300015373 | Arabidopsis Rhizosphere | MTDVQGDDIRQLLREIRDAQREQLAEYRRVTERSLDLQQRAVGR |
Ga0182040_100750961 | 3300016387 | Soil | MDSDDDVRQLLRDIRDAQRDQLAEYRALFERVLDLQQRAVA |
Ga0184638_12659182 | 3300018052 | Groundwater Sediment | MDSDDEIRQLLRDIRDAQREHLAECRRVTERSLELQQRAVAQQEQ |
Ga0184623_105084501 | 3300018056 | Groundwater Sediment | MESDDEISQLLRDIRDAQREHLAESRRVTERSLELQQRAVAQQ |
Ga0184632_104250242 | 3300018075 | Groundwater Sediment | MDSDDEIRQLLRDIRDAQREHLAECRRVTERSLELQQRAVAQQEQMSHL |
Ga0184639_100067251 | 3300018082 | Groundwater Sediment | MESDDEISQLLRDIRDAQREHLAESRRVTERSLELQQRAVAQQEQMSHL |
Ga0066662_110475731 | 3300018468 | Grasslands Soil | MERDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRSVTRQEQIGHLYRRLML |
Ga0066662_113551692 | 3300018468 | Grasslands Soil | MDESDQIKILAEIRDVQREHLAEYRKVAQQSLALQQQ |
Ga0184646_12657411 | 3300019259 | Groundwater Sediment | MDSDDEISQLLRDIRDAQREHLAECRRVTERSLELQQRAVAQQEQM |
Ga0137408_10087391 | 3300019789 | Vadose Zone Soil | MEGGDEIRQLLREIRDAQREQLAEYRRVTERSLELQQRAVARQEQIGHPPGRSRSA |
Ga0179594_103547361 | 3300020170 | Vadose Zone Soil | VNDDDEIRQLLRDIRDAQREHGAEYRRVTERLVELQERAVT |
Ga0179592_101954423 | 3300020199 | Vadose Zone Soil | MECDDETRRLLGEIRDAQREQLAEYRRVTERSLELQQRAGTRQE |
Ga0210377_100622184 | 3300021090 | Groundwater Sediment | MEADEDTRRLLEEIRDAQREYLVEYRRVTQQSLELQQRAVDRQSKSA |
Ga0207669_106925652 | 3300025937 | Miscanthus Rhizosphere | MDSDEIGPLLQEIRDTQREHLAEYRRVTERSLELQQRAVTRQEQFGHLY |
Ga0207704_109159681 | 3300025938 | Miscanthus Rhizosphere | MQSDDDVRQLLRDIRDAQREQLAEHRSVMDRVLELQRRAVVQQ |
Ga0207689_108945421 | 3300025942 | Miscanthus Rhizosphere | MDNDDRVVTLLQEIRDAQREHLAEYRKVAQRSVELQEEAVARQQN |
Ga0207703_110153022 | 3300026035 | Switchgrass Rhizosphere | MQSDDDVRQLLRDIRDAQREQLAEHRSVMDRVLEIQR |
Ga0209154_11724681 | 3300026317 | Soil | MEGDEIRQLLKEIRDTQREHLAEYRRVTERSLELQQRAVARQEQMAT |
Ga0209801_12580742 | 3300026326 | Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGQLYR |
Ga0209808_10882783 | 3300026523 | Soil | MEGDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRRLLLVGGVL |
Ga0209161_104764892 | 3300026548 | Soil | MESDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVT |
Ga0209474_102181311 | 3300026550 | Soil | MERDDETRRLLREIRDAQREQLDEYRRVTERSLELQQRAVTRQEQIGHLYRRLMLVGGVL |
Ga0209474_104486321 | 3300026550 | Soil | MTSEGEVRVLLREIRDTQREHLAEYRRVTERSPDLQQRAVARQ |
Ga0209887_10965131 | 3300027561 | Groundwater Sand | MESDDELRLLLRDIRDAQREHLVECRRVTERSLELQQRAVAQQEQL |
Ga0209588_12533531 | 3300027671 | Vadose Zone Soil | MERDDETHRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRYLFVTGIVGVG |
Ga0209689_10501513 | 3300027748 | Soil | MERDDETRRLLREIRDAQREQLAEYRRVTERSLELQQRAVTRQEQIGHLYRYLFATGIVGVG |
Ga0209397_105294842 | 3300027871 | Wetland | MEGDDRTHSLLEEIRDAQRDHLAEYRRVTQRSLDLQQRAVDRQQELGRLYR |
Ga0209814_101269581 | 3300027873 | Populus Rhizosphere | MDDGNEIRQLLREIRDAQREQLAEYRRVTERSLELQ |
Ga0209465_102481952 | 3300027874 | Tropical Forest Soil | MDKDDDVRHLLRDIRDAQRDQLAEYRGLLERVLELQQRAVAQG |
Ga0209481_103051841 | 3300027880 | Populus Rhizosphere | MDGSDEIRQLLREIRDTQREQLAEYRKVAERSLELQQRAVARQEQIGHFSRRLMVG |
Ga0209048_102407082 | 3300027902 | Freshwater Lake Sediment | MEADGHTHQLLEEIRDAQREYLAKYRRVTQQSLELQQRAVARQEQVSLI |
Ga0207428_111893122 | 3300027907 | Populus Rhizosphere | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQHRAVARQEQI |
Ga0137415_100450804 | 3300028536 | Vadose Zone Soil | MDSDEIRQLLKEIRDTQREHLAEYRRVTERSLDLQQRAVARQEQIANVYRRLL |
Ga0247822_109808691 | 3300028592 | Soil | MTSPDGDEIQKLLSEIRDTQREHLAEYKSVTQRSLELQQRAVARQEQIRRFTRQIVLVGG |
Ga0302046_103750092 | 3300030620 | Soil | MQDSEEIKKLLIEIRDAQLEQLAEYRRVTQRSLELQQQAVT |
(restricted) Ga0255311_10051342 | 3300031150 | Sandy Soil | MDSENEIRQLLKDIRDTQREHLAEYRRVTERSLELQQRAV |
Ga0307499_100835132 | 3300031184 | Soil | MDNDEIGRLLQEIRDIQREHLAEYRRVTERSLELQQRAVTRQEQFGHLYRRILVVGGGMVAILLV |
(restricted) Ga0255312_10347081 | 3300031248 | Sandy Soil | MDSENEIRQLLKDIRDTQREDLAEYRRVTERSLELQQRAVTRQEQM |
Ga0307505_103870062 | 3300031455 | Soil | MENDEIGRLLQEIRDTQREHLAEYRRVTERSLELQQRAVTRQEQFGHLYRRILV |
Ga0307469_100654381 | 3300031720 | Hardwood Forest Soil | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQQRAVARQEQIGRFTR |
Ga0307469_101970422 | 3300031720 | Hardwood Forest Soil | MEGDEIRTLLREIRDTQREHLAEYRQVTQRSLELQQ |
Ga0307469_119002832 | 3300031720 | Hardwood Forest Soil | MDNDAIGRLLQEIRDTQREHLAEYRRVTERSLELQQRAV |
Ga0318576_105678212 | 3300031796 | Soil | MDSDDDVRQLLRDIRDAQRDQLAEYRALFERVLDLQQRAVAQQE |
Ga0310913_110087171 | 3300031945 | Soil | MDSDDDVRQLLRDIRDAQRDQLAEYRALFERVLELQQRAVAQQEQASRLY |
Ga0318559_104812132 | 3300032039 | Soil | MDSDDDVRQLLRDIRDAQRDQLAEYRALFERVLELQQRAVAQQEQAS |
Ga0318556_107268261 | 3300032043 | Soil | MDSDDDVRQLLRDIRDAQRDQLAEYRALFERVLDLQ |
Ga0307471_1000095521 | 3300032180 | Hardwood Forest Soil | MEGDEIQKLLREIRDTQREHLAEYRSVTQRSLELQQRAVARQEQIGRFT |
Ga0307472_1025872252 | 3300032205 | Hardwood Forest Soil | MTDVQGDDIRQLLREIRDAQREQLAEYRRVTERSL |
Ga0316622_1008113791 | 3300033416 | Soil | MERDEEIRKLLQDIRDAQREHLAEYRRVAERSLEIQERAVARQEQAG |
Ga0316628_1029511332 | 3300033513 | Soil | MDQDEEIRKLLQDIRDAQREHLAEYRRVAERSLEIQERAVARQEQAGRLVRQI |
Ga0373908_092456_457_594 | 3300034085 | Sediment Slurry | MEADEHTHRLLEEIRDAQREHLAEYRRVTRQSLELQQRAVARQEQI |
⦗Top⦘ |