NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073707

Metagenome / Metatranscriptome Family F073707

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073707
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 45 residues
Representative Sequence LKRTLLWLIVAAVLVIGFLLYRSRSGSNLNVTPDAEREIEKAKRR
Number of Associated Samples 102
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.55 %
% of genes near scaffold ends (potentially truncated) 19.17 %
% of genes from short scaffolds (< 2000 bps) 66.67 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.333 % of family members)
Environment Ontology (ENVO) Unclassified
(31.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.21%    β-sheet: 0.00%    Coil/Unstructured: 54.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF00196GerE 6.67
PF00873ACR_tran 6.67
PF14079DUF4260 4.17
PF01176eIF-1a 2.50
PF02837Glyco_hydro_2_N 1.67
PF02472ExbD 1.67
PF05199GMC_oxred_C 1.67
PF04972BON 1.67
PF11154DUF2934 1.67
PF12543DUF3738 1.67
PF01594AI-2E_transport 1.67
PF01011PQQ 1.67
PF09206ArabFuran-catal 1.67
PF02585PIG-L 0.83
PF04365BrnT_toxin 0.83
PF01804Penicil_amidase 0.83
PF13439Glyco_transf_4 0.83
PF02922CBM_48 0.83
PF01636APH 0.83
PF01593Amino_oxidase 0.83
PF12796Ank_2 0.83
PF02566OsmC 0.83
PF01435Peptidase_M48 0.83
PF01740STAS 0.83
PF06271RDD 0.83
PF00939Na_sulph_symp 0.83
PF12700HlyD_2 0.83
PF01381HTH_3 0.83
PF12419DUF3670 0.83
PF13673Acetyltransf_10 0.83
PF01613Flavin_Reduct 0.83
PF07638Sigma70_ECF 0.83
PF02518HATPase_c 0.83
PF07730HisKA_3 0.83
PF05973Gp49 0.83
PF04397LytTR 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 2.50
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.67
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 1.67
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 1.67
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 1.67
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.83
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.83
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.83
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.83
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.83
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.83
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.83
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.83
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.83
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.83
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.83
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.83
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.83
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.83
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.83
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.67 %
UnclassifiedrootN/A48.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101613538All Organisms → cellular organisms → Bacteria → Acidobacteria4430Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105887167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1283Open in IMG/M
3300000789|JGI1027J11758_12628304All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300004080|Ga0062385_10124673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Chroococcaceae → Gloeocapsa1291Open in IMG/M
3300005330|Ga0070690_100723363Not Available766Open in IMG/M
3300005334|Ga0068869_100092391All Organisms → cellular organisms → Bacteria2278Open in IMG/M
3300005365|Ga0070688_100154238All Organisms → cellular organisms → Bacteria → Acidobacteria1572Open in IMG/M
3300005436|Ga0070713_100015997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5629Open in IMG/M
3300005436|Ga0070713_100458645All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300005447|Ga0066689_10582831Not Available706Open in IMG/M
3300005458|Ga0070681_10792967Not Available864Open in IMG/M
3300005529|Ga0070741_11404119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea580Open in IMG/M
3300005535|Ga0070684_100670313All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300005535|Ga0070684_101044795All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300005538|Ga0070731_10483374Not Available824Open in IMG/M
3300005549|Ga0070704_101275686Not Available671Open in IMG/M
3300005577|Ga0068857_100807918All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300005614|Ga0068856_100134642All Organisms → cellular organisms → Bacteria2476Open in IMG/M
3300005617|Ga0068859_102655762Not Available551Open in IMG/M
3300005952|Ga0080026_10101343All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300006050|Ga0075028_100860182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300006237|Ga0097621_100028520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4399Open in IMG/M
3300006893|Ga0073928_10060275All Organisms → cellular organisms → Bacteria → Proteobacteria3357Open in IMG/M
3300006893|Ga0073928_10996893Not Available571Open in IMG/M
3300009098|Ga0105245_11440345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria739Open in IMG/M
3300009098|Ga0105245_12120330Not Available616Open in IMG/M
3300009148|Ga0105243_10181243All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300009174|Ga0105241_10395122All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae1211Open in IMG/M
3300009523|Ga0116221_1360134Not Available631Open in IMG/M
3300009551|Ga0105238_12532063All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009628|Ga0116125_1001323All Organisms → cellular organisms → Bacteria10841Open in IMG/M
3300009640|Ga0116126_1254902Not Available549Open in IMG/M
3300010373|Ga0134128_11677996All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300010379|Ga0136449_100139685All Organisms → cellular organisms → Bacteria → Proteobacteria4794Open in IMG/M
3300010379|Ga0136449_103154997All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300010379|Ga0136449_103193998Not Available633Open in IMG/M
3300010401|Ga0134121_10344564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1331Open in IMG/M
3300010403|Ga0134123_11039748Not Available838Open in IMG/M
3300011119|Ga0105246_10764799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans853Open in IMG/M
3300012199|Ga0137383_11026021Not Available600Open in IMG/M
3300012205|Ga0137362_10167039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1887Open in IMG/M
3300012207|Ga0137381_11360873Not Available602Open in IMG/M
3300012210|Ga0137378_11767534All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012362|Ga0137361_10193969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1835Open in IMG/M
3300012363|Ga0137390_10698543All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300012582|Ga0137358_10653260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4704Open in IMG/M
3300012917|Ga0137395_10578045All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300012960|Ga0164301_10774402Not Available731Open in IMG/M
3300013104|Ga0157370_10049676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4014Open in IMG/M
3300013306|Ga0163162_10823237Not Available1045Open in IMG/M
3300013306|Ga0163162_12572241Not Available586Open in IMG/M
3300013308|Ga0157375_10758994All Organisms → cellular organisms → Bacteria → Acidobacteria1121Open in IMG/M
3300013308|Ga0157375_12914502Not Available572Open in IMG/M
3300014156|Ga0181518_10422431Not Available641Open in IMG/M
3300014162|Ga0181538_10494651Not Available644Open in IMG/M
3300014162|Ga0181538_10668385Not Available539Open in IMG/M
3300014165|Ga0181523_10067395Not Available2188Open in IMG/M
3300014325|Ga0163163_10023956All Organisms → cellular organisms → Bacteria → Acidobacteria5805Open in IMG/M
3300015264|Ga0137403_10984595All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018034|Ga0187863_10045737All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halococcaceae → Halococcus → Halococcus hamelinensis → Halococcus hamelinensis 100A62519Open in IMG/M
3300018034|Ga0187863_10177480All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300018043|Ga0187887_10026588All Organisms → cellular organisms → Bacteria3677Open in IMG/M
3300018089|Ga0187774_10364258All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300020580|Ga0210403_10201567All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300020581|Ga0210399_11296277All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300020581|Ga0210399_11342560Not Available561Open in IMG/M
3300021170|Ga0210400_10638231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4877Open in IMG/M
3300021178|Ga0210408_10237573Not Available1451Open in IMG/M
3300021407|Ga0210383_11788514Not Available501Open in IMG/M
3300022557|Ga0212123_10215627All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300022726|Ga0242654_10078884Not Available995Open in IMG/M
3300025912|Ga0207707_11326842Not Available577Open in IMG/M
3300025928|Ga0207700_10713920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans895Open in IMG/M
3300025930|Ga0207701_11460635All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025935|Ga0207709_10651612Not Available838Open in IMG/M
3300025961|Ga0207712_10362973Not Available1207Open in IMG/M
3300026078|Ga0207702_10080115All Organisms → cellular organisms → Bacteria2832Open in IMG/M
3300027660|Ga0209736_1043972All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300027842|Ga0209580_10417887All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300027869|Ga0209579_10641917Not Available575Open in IMG/M
3300027986|Ga0209168_10017624Not Available4084Open in IMG/M
3300029636|Ga0222749_10669418Not Available568Open in IMG/M
3300029882|Ga0311368_10164744All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300029910|Ga0311369_10110676All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-52740Open in IMG/M
3300030617|Ga0311356_11004095All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031090|Ga0265760_10053331Not Available1220Open in IMG/M
3300031234|Ga0302325_10326386All Organisms → cellular organisms → Bacteria → Acidobacteria2463Open in IMG/M
3300031234|Ga0302325_11093649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1075Open in IMG/M
3300031250|Ga0265331_10291562Not Available731Open in IMG/M
3300031708|Ga0310686_108477113All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300031716|Ga0310813_11565028Not Available615Open in IMG/M
3300031718|Ga0307474_10165283All Organisms → cellular organisms → Bacteria → Acidobacteria1675Open in IMG/M
3300031823|Ga0307478_10052733All Organisms → cellular organisms → Bacteria → Acidobacteria3021Open in IMG/M
3300031938|Ga0308175_103086405Not Available518Open in IMG/M
3300032160|Ga0311301_10632798All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300032160|Ga0311301_12200082Not Available633Open in IMG/M
3300033480|Ga0316620_10060829All Organisms → cellular organisms → Bacteria2650Open in IMG/M
3300033486|Ga0316624_11655968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300033513|Ga0316628_101595218All Organisms → cellular organisms → Bacteria869Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.17%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.50%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.50%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10161353853300000364SoilMGLRRFLLWLIIVAVLLIGLLLYRSRSGNNLSITPEAEQEIEKAKRR*
INPhiseqgaiiFebDRAFT_10588716723300000364SoilLLWLIVTALLVTGFAIYRSRSTRLNVTPDAAREIEKAKRR*
JGI1027J11758_1262830413300000789SoilVRRALLWLIVTALLVTGFAIYRSRSTRLNVTPDAAREIEKAKRR
Ga0062385_1012467313300004080Bog Forest SoilMWVILMKRILPWLIGAAVLVIGFAFYRSRSRSHLNVDPHALEEIERAKRR*
Ga0062384_10078616613300004082Bog Forest SoilMRRILLWSIVAAILLAAVVYFARSRNHLDVTPDAAREIEKAKQR*
Ga0070690_10072336323300005330Switchgrass RhizosphereLLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR*
Ga0068869_10009239133300005334Miscanthus RhizosphereVKQLSVKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR*
Ga0070688_10015423823300005365Switchgrass RhizosphereLLWLIVTALLVTGFLVYRSRSKTRLNVTPDAAREIEKAKRQ*
Ga0070709_1003922033300005434Corn, Switchgrass And Miscanthus RhizosphereVRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR*
Ga0070713_10000428853300005436Corn, Switchgrass And Miscanthus RhizosphereVRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKTKRR*
Ga0070713_10001599733300005436Corn, Switchgrass And Miscanthus RhizosphereMKRSLLWLIVVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR*
Ga0070713_10045864523300005436Corn, Switchgrass And Miscanthus RhizosphereVKRILLWLVIAGILVIALVLYRSRSRSNLNVAPDAEREIEKAKRK*
Ga0070711_10005133913300005439Corn, Switchgrass And Miscanthus RhizosphereVRKLVVLLIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR*
Ga0066689_1058283123300005447SoilVKRILVWLIVTAALLIAFVLYRSRSGSNLNIEPHAREVIEKAKGR*
Ga0070681_1079296723300005458Corn RhizosphereMNRILLWLIVALALLIGFVLYRSHSATKLNVTPEAEREIEKAKRR*
Ga0070741_1140411913300005529Surface SoilLSYFGGVKRTWVWLIVAAALVIGFVLYRSSSGRKQLNVTPDAEREIEKAKRR*
Ga0070734_1003587233300005533Surface SoilLIAVALMVVLLLAFILYRSRSADQLEVDPHAAKEIEKAKRR*
Ga0070684_10067031313300005535Corn RhizosphereMTRILLWLIVAAVLVIGFLFYRSQPRDRLNVTSYAEQEIERAKR
Ga0070684_10104479523300005535Corn RhizosphereMKRSLLWLIVVAALLAGWLLYRFKSGSDLIVTPDAAQEIEKAERR*
Ga0070730_1040418523300005537Surface SoilVKKLVVLLIVVAILLIGVIVYRARSTRQLDVDPDAAREIEKAKRR*
Ga0070731_1048337423300005538Surface SoilVKRILLRLTVAAALVIGFVLYRSRKRSDLNVEPNAREVIEKAKRR*
Ga0070732_1034145423300005542Surface SoilVKKMLPWLIALAILLIGVVVYRARSTRRLNVDPAAAREIEKAKQR*
Ga0070704_10127568613300005549Corn, Switchgrass And Miscanthus RhizosphereVVPVRRALLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR*
Ga0068857_10080791813300005577Corn RhizosphereVKQLLLWLIVAAVLMVGFLLYRSRSRGSLNVTPDAQQEIEQGKAAVVD
Ga0068856_10013464243300005614Corn RhizosphereMKRSLLWLIVVAALLGGWLLYRFKSGSDLNVTPDAAQEIEKAERR*
Ga0068859_10265576223300005617Switchgrass RhizosphereVKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR*
Ga0080026_1010134323300005952Permafrost SoilVKRILIWFIVAAVLAIGFVLYRSRPASRLDVPQDAQREIERAKQR*
Ga0075028_10086018223300006050WatershedsVKRTLLRLIVAAALIIAFVWYRSRPRMRLNVTPDAARKIEKAKRR*
Ga0097621_10002852073300006237Miscanthus RhizosphereMKRALLWLIVAAGLVAGLLLYRSRSGSDLNITPEASQEIEKAKRR*
Ga0073928_1006027543300006893Iron-Sulfur Acid SpringVKRILLWLIVIAVLVIGFVLYRSRSGSHLNVAPDAQREIDKAKRR*
Ga0073928_1099689323300006893Iron-Sulfur Acid SpringMKRVLLWLIVAALLVIGFVLYRARSGSDLNVTRDAADEIEKAKRR*
Ga0075426_1149066033300006903Populus RhizosphereVLIALIALALLLIGFILYRSRSTNQLDVDPEAAREIEKAKRR*
Ga0099830_1092051813300009088Vadose Zone SoilVRRLVVLLIVAAILLIGVVVYRSRSTRQLNVDPDAAREIEKAKLR*
Ga0105245_1144034523300009098Miscanthus RhizosphereLIVAAILLAGLLLYRSQSGSTLNVTPDAAREIEGAKRR*
Ga0105245_1212033023300009098Miscanthus RhizosphereMTRALLWLIGGVVLLIAFVLYRSTSVSDLNVTPDAAREIDGARRR*
Ga0105243_1018124313300009148Miscanthus RhizosphereVKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDARREIEKAKRR*
Ga0105241_1039512233300009174Corn RhizosphereVKRRLLWLIVAAILLAGLVLYRSRSGSTLNVTPDAAREIERAKQR*
Ga0116221_136013413300009523Peatlands SoilMKRAMLWLIAAAVLLVAFLVYRSRSGSDFQVTPDAAREIERAKRR*
Ga0105238_1253206323300009551Corn RhizosphereMKRALLWLSFAAALAIAFMLYRSWSGTRLNVTPDARREIEKAKRR*
Ga0116125_100132393300009628PeatlandMKKILLWLVVVAVLVIGFVVYRSRSRNHLDVTPDARREIEKAKRR*
Ga0116126_125490223300009640PeatlandAMRLLPHAVLEIGFVLYRSLLGIHLNLTPDAERKIEKARRR*
Ga0126372_1215293413300010360Tropical Forest SoilVRKALVALIAVAILLIAYAVYRSRSDGLNVDPDAAKEIEKAKRR*
Ga0134128_1167799623300010373Terrestrial SoilKHTLIWLIATAILMTGLVLYRSQSRGHLNVTPDAEREIEKARRR*
Ga0136449_10013968543300010379Peatlands SoilVKRLLLWFFVAVLAIAFVLHRSRSGMRLKVTPDAEREIEKAKRR*
Ga0136449_10315499723300010379Peatlands SoilMRKILVWLIVAAVLVIGFVLYRSWSGNRLDVTPDAEHEIEKAKRR*
Ga0136449_10319399813300010379Peatlands SoilGRTTNMETDRSMKRILLWLIFAAVLVIGFVLYSSWSATQLNVTPDAEHEIEKAKRR*
Ga0134121_1034456423300010401Terrestrial SoilLLIVTILLVTVFVIYRSRSTRLNVTPDAAREIEKAKRR*
Ga0134123_1103974823300010403Terrestrial SoilMRLFLAIILIALLLITFRVYRSRSASHLNVTPDAEREIEKAKRR*
Ga0105246_1076479923300011119Miscanthus RhizosphereMKRALLWLIVAAGLVAGLLLYRSRSGNDLNITPDASQEIEKAKRR*
Ga0137383_1102602113300012199Vadose Zone SoilMKAGPTPMKKILLWIIVVAALALGFVLYRSRSRTHLNVTPDAEREIEKAKRR*
Ga0137362_1016703933300012205Vadose Zone SoilMKKILPWIIIVAALAIGFVVYRSRSGTHLNVTPDAEREIEKAKRR*
Ga0137381_1136087313300012207Vadose Zone SoilMKRILLWLIVAAALVIGFVFYRSRSGSNLNVTPDAEPEIEKAKRR*
Ga0137378_1176753423300012210Vadose Zone SoilMKKILIFVIVAAVLLIVFGVYRSRSRDHLDITPDAKREIEKAKRR*
Ga0137361_1019396913300012362Vadose Zone SoilPIPAGTTMEWVHLKHTLLWLIVAAVLVIGFVLYRSRSRTHLNVTPDAEREIEKAKRR*
Ga0137390_1069854323300012363Vadose Zone SoilVVHVKGILLWLIVAALLVMGFVLYRSRSGNHLNVTPDAEREIEKAKRR*
Ga0137358_1065326023300012582Vadose Zone SoilMKAGPTPMKKILLWIIVVAALAIGFVLYRSRSRTHLNVTPDAEREIEKAKRR*
Ga0137395_1057804533300012917Vadose Zone SoilMKAGPMLMKKILLWLIVAAALMIGFALYRSRSGTHLNVTPDAE
Ga0164301_1077440223300012960SoilMKRTVFWLIVAALLVLGLMVYRSRSRSDLNVAPDAAEEIEKAKRR*
Ga0157370_1004967633300013104Corn RhizosphereMKRTLLWLIVAAALVLAFLLYHSHSATKLNVTPDAEREIEKAKRR*
Ga0163162_1082323733300013306Switchgrass RhizosphereVKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDAEREIEKAKRR*
Ga0163162_1257224123300013306Switchgrass RhizosphereMNRILLWLIIALVLMIGFVLYRSHSTTKLNVTPDAQRE
Ga0157375_1075899423300013308Miscanthus RhizosphereVRSALLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR*
Ga0157375_1291450213300013308Miscanthus RhizosphereMKQLLLWLVVAVVVLIGFLLYRASSENHLNVAPEAEREIEKAKRR*
Ga0181518_1042243123300014156BogLGDVKRTVLWLIVAAILAIGFVLHRSRAGSNLNVTPDAAREIEKAKRR*
Ga0181538_1049465113300014162BogNLSDVKRTVNWVIAAAILVIAFVLYRSRSGSNLNVTPDAAPEIEKVKQR*
Ga0181538_1066838513300014162BogLNRTLSWLIVAAALLIGLVLYHSRSRNHLDVTPDAEREIEKAKRR*
Ga0181523_1006739513300014165BogSEPPLNRTLSWLIVAAALLIGLALYHSRSRNHLDVTPDAEREIEKAKRR*
Ga0163163_1002395673300014325Switchgrass RhizosphereMKRALLWLIVAAGLVAGLLLYRSRSGSDLNITPDASQEIEKAKRR*
Ga0137403_1098459513300015264Vadose Zone SoilVGDLNLKRILLLIIVAGLIAIGFLLFRSRPADRLDVTPDAAREIEKAKGR*
Ga0187863_1004573733300018034PeatlandMKKILLWLVVVAVLVIGFVVYRSRSRNHLDVTPDARREIEKAKRR
Ga0187863_1017748033300018034PeatlandYGRPLKRIVLWLIVAVVLVAGFVVFHSRSGPHLNVTPDAAREIEKAKRR
Ga0187887_1002658823300018043PeatlandMKKILLWLIVAAMLVIGFAVYRSRSRNHLDVTPDAQREIERAKRR
Ga0187774_1036425813300018089Tropical PeatlandVKQALLWLFVVVLVIAFVFYRSRPRIHLNVTPEAER
Ga0210407_1036276713300020579SoilVLLIVVAILLIVAMVYRSRSTRELNVDPDAAREIEKAKRH
Ga0210407_1067139023300020579SoilVRKFAVLLIVLAILLIAVMVYRSRSTRQLNVDPDASREIEKT
Ga0210403_1020156733300020580SoilMKRALLWLIVAAVLLIGFVLYRARSGSDLNVTPDAAREIEKAKRR
Ga0210399_1125695123300020581SoilVRKFVVLLIVLAILLIVMVYRSKSTRQLNVDPDAAREIEKAKRR
Ga0210399_1129627723300020581SoilMKRILLFLILIAVLVIGLMLYRSRSGRLNVTPDAEREIEKAKRR
Ga0210399_1134256023300020581SoilMKRVLLWLIVAAVLVIGFVLYRARSGSGPNVTPDAAQEIEKAMRR
Ga0210406_1071834513300021168SoilVKKFVVLLIVLASLLIAVIVYRSRSTRQLNVDPDAAQEIEKA
Ga0210400_1020582023300021170SoilVKKFVVLLIVLASLLIAVIVYRSRSTRQLNVDPDAAQEIEKAKRR
Ga0210400_1063823123300021170SoilVKQILLWLIVALVLVIGFLLYRSRSGDHLNVTPEAQREIEKAERR
Ga0210408_1023757323300021178SoilMNRVLLWLIVAAVLVIGFVLYRSRSGGDLNVTPEAEQEIERAKRR
Ga0210383_1178851413300021407SoilLNVKRILLWLILAAVLAIGFLVYRSRSESHLDVTPDAAREIEKAKRR
Ga0210384_1065186223300021432SoilVRKFVVLLIVVAILLIVAMVYRSRSTRELNVDPDAAREIEKAKRH
Ga0210402_1092677313300021478SoilVRKLVVLLIVLAILLIAVMVYRSRSTRQLNVDPDAAREIEKAKRR
Ga0210409_1014201633300021559SoilVRKFAVLLIVLAILLIAVMVYRSRSTRQLNVDPDASREIEKTKRR
Ga0212123_1021562723300022557Iron-Sulfur Acid SpringVKRILLWLIVIAVLVIGFVLYRSRSGSHLNVAPDAQREIDKAKRR
Ga0242654_1007888423300022726SoilKRILLWLILAAALIIGVMFYRSRSGSRLDITPDAAREIEKAKQR
Ga0207707_1132684213300025912Corn RhizosphereILLWLIVALALLIGFVLYRSHSATKLNVTPEAEREIEKAKRR
Ga0207663_1022984713300025916Corn, Switchgrass And Miscanthus RhizosphereVRKLVVLVIVLAILLIAVMVYRSRSTRQLNVDPDA
Ga0207700_1071392023300025928Corn, Switchgrass And Miscanthus RhizosphereMKRSLLWLIVVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR
Ga0207701_1146063523300025930Corn, Switchgrass And Miscanthus RhizosphereLLWLIVTALLVTGFVIYRSRSTRLNVTPDAAREIEKAKRR
Ga0207709_1065161213300025935Miscanthus RhizosphereVKQLLLWLVLAVVVLIGFLLYRAASGNHLDVTPDARREIEKAKRR
Ga0207712_1036297313300025961Switchgrass RhizosphereVKQLLLWLVVAAVVLIGFLLYRGTSGNHLDVTPDAEREIEKAKRR
Ga0207702_1008011523300026078Corn RhizosphereMKRSLLWLISVAALLAGWLLYRFKSGSDLNVTPDAAQEIEKAERR
Ga0209736_104397223300027660Forest SoilLKYIVAAVLVIGFVLYRSHSATKLNVTPDAEREIEKAKRR
Ga0209060_1010724233300027826Surface SoilLIAVALMVVLLLAFILYRSRSADQLEVDPHAAKEIEKAKRR
Ga0209580_1041788713300027842Surface SoilMKRIILFLGLIAVLVIGLMLYRSRSGHLDVTPDAEREIEKAKRR
Ga0209579_1064191723300027869Surface SoilVKRILLRLTVAAALVIGFVLYRSRKRSDLNVEPNAREVIEKAKRR
Ga0209168_1001762423300027986Surface SoilVKRTVLWLIVVAALFIAFLLYRSRSGDKLDVAPGAEREIEKARRR
Ga0222749_1066941813300029636SoilMKRIILFPILIAALVVGLMLYRSRSGRLNVTPDAEREIEKAKRR
Ga0311368_1016474423300029882PalsaMKRILLLVIAAAALIIGILIYRSHTRTHLDVTPEAEREIEKAKRR
Ga0311369_1011067643300029910PalsaKTRGMKRILLLVIAAAALIIGILIYRSHTRTHLDVTPEAEREIEKAKRR
Ga0311356_1100409523300030617PalsaMKRILLLVIAAAALIIGYLIYRSHTRTHLDVTPEAEREIEKAKRR
Ga0265760_1005333113300031090SoilNCKIQGVSNMNRILLWLILAAVLVIGFLLYRSRSEPHLDVTPDAAREIEKAKRR
Ga0302325_1032638613300031234PalsaMSNVNRILLWLILASLLAIGFLLYRSRSGPRWDVTPDAAREIEKAKR
Ga0302325_1109364933300031234PalsaMKRILLWLLVAATLVIALIVCRSWSDSDVNVTPDAAREIEKAKRR
Ga0265331_1029156223300031250RhizosphereLGDVKRTVIWLIAAAILVVAFVLYRFQSGSNLNVTPGAAREIEKAKRR
Ga0310686_10847711333300031708SoilMAHAKRILFWLIVAAVSVVGFLLYRSQSRSSLNVTPNAREVIEKAKRR
Ga0310813_1156502823300031716SoilMKWDVPVRRALLWLIVAALLVTGFIVYRSRSTRLNVTPDAAREIEKAKRR
Ga0307474_1016528323300031718Hardwood Forest SoilWLIVAVILVIGFAVYRSRSRNHLEVTPEAGREIERAKRR
Ga0307475_1023414633300031754Hardwood Forest SoilVRRLVVLLIVLAILLIGVIVYRSRSSRQLNVDPDAAREIEKAKRH
Ga0307478_1005273323300031823Hardwood Forest SoilMKKILVWLIVAVILVIGFAVYRSRSRNHLEVTPEAGREIERAKRR
Ga0308175_10308640523300031938SoilMKRPLLWLIVGAILLVSFALYRSHSGSDLQVTPDAAREIEKAKRR
Ga0311301_1063279823300032160Peatlands SoilVKRLLLWFFVAVLAIAFVLHRSRSGMRLKVTPDAEREIEKAKRR
Ga0311301_1220008223300032160Peatlands SoilGRTTNMETDRSMKRILLWLIFAAVLVIGFVLYSSWSATQLNVTPDAEHEIEKAKRR
Ga0316620_1006082933300033480SoilLKRTLLWLIVAAVLVIGFLLYRSRSGSNLNVTPDAEREIEKAKRR
Ga0316624_1165596823300033486SoilLKRTLLWLIVAAVLVIGFLLYRSRSGRNLNVTPDAEREIEKAKRR
Ga0316628_10159521823300033513SoilMKRTLLWVLVAAILLVGFLLYRSQSGSDLNVTPDAAQEIEKAKRR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.